KEGG   Mycobacterium tuberculosis CCDC5079: CFBS_1929Help
Entry
CFBS_1929         CDS       T02679                                 

Gene name
glcB
Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
mtur  Mycobacterium tuberculosis CCDC5079
Pathway
mtur00620  Pyruvate metabolism
mtur00630  Glyoxylate and dicarboxylate metabolism
mtur01100  Metabolic pathways
mtur01110  Biosynthesis of secondary metabolites
mtur01120  Microbial metabolism in diverse environments
mtur01200  Carbon metabolism
Module
mtur_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mtur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CFBS_1929 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    CFBS_1929 (glcB)
Enzymes [BR:mtur01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     CFBS_1929 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AGM00362
Structure
PDB: 

Position
complement(2070039..2072264)
Genome map
AA seq 741 aa AA seqDB search
MTDRVSVGNLRIARVLYDFVNNEALPGTDIDPDSFWAGVDKVVADLTPQNQALLNARDEL
QAQIDKWHRRRVIEPIDMDAYRQFLTEIGYLLPEPDDFTITTSSVDAEITTTAGPQLVVP
VLNARFALNAANARWGSLYDALYGTDVIPETDGAEKGPTYNKVRGDKVIAYARKFLDDSV
PLSSGSFGDATGFTVQDGQLVVALPDKSTGLANPGQFAGYTGAAESPTSVLLINHGLHIE
ILIDPESQVGTTDRAGVKDVILESAITTIMDFEDSVAAVDAADKVLGYRNWLGLNKGDLA
AAVDKDGTAFLRVLNRDRNYTAPGGGQFTLPGRSLMFVRNVGHLMTNDAIVDTDGSEVFE
GIMDALFTGLIAIHGLKASDVNGPLINSRTGSIYIVKPKMHGPAEVAFTCELFSRVEDVL
GLPQNTMKIGIMDEERRTTVNLKACIKAAADRVVFINTGFLDRTGDEIHTSMEAGPMVRK
GTMKSQPWILAYEDHNVDAGLAAGFSGRAQVGKGMWTMTELMADMVETKIAQPRAGASTA
WVPSPTAATLHALHYHQVDVAAVQQGLAGKRRATIEQLLTIPLAKELAWAPDEIREEVDN
NCQSILGYVVRWVDQGVGCSKVPDIHDVALMEDRATLRISSQLLANWLRHGVITSADVRA
SLERMAPLVDRQNAGDVAYRPMAPNFDDSIAFLAAQELILSGAQQPNGYTEPILHRRRRE
FKARAAEKPAPSDRAGDDAAR
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgacagatcgcgtgtcggtgggcaacttgcgcatcgctcgggtgctctacgacttcgtg
aacaatgaagccctgcctggcaccgatatcgacccggacagcttctgggcgggcgtcgac
aaggtcgtcgccgacctgaccccgcagaaccaagctctgttgaacgcccgcgacgagctg
caggcgcagatcgacaagtggcaccggcgtcgggtgatcgagcccatcgacatggatgcc
taccgccagttcctcaccgagatcggctacctgcttcccgaacctgatgacttcaccatc
accacgtccagtgtcgacgctgagatcaccacgaccgccggcccccagctggtggtgccg
gtgctcaacgcgcggtttgctctgaacgcggccaacgctcgctggggctccctctacgac
gccttgtatggcaccgatgtcatccccgagaccgacggcgccgaaaaaggccccacgtac
aacaaggttcgtggcgacaaggtgatcgcgtatgcccgcaagttcctcgacgacagtgtt
ccgctgtcgtcgggttcctttggcgacgccaccggtttcacagtgcaggatggccagctc
gtggttgccttgccggataagtccaccggcctggccaaccccggccagttcgccggctac
accggcgcagccgagtcgccgacatcggtgctgctaatcaatcacggtttgcacatcgag
atcctgatcgatccggagtcgcaggtcggcaccaccgaccgggccggcgtcaaggacgtg
atcctggaatccgcgatcaccacgatcatggacttcgaggactcggtggccgccgtggac
gccgccgacaaggtgctgggttatcggaactggctcggcctgaacaagggcgacctggca
gcagcggtagacaaggacggcaccgctttcctgcgggtgctcaatagggaccggaactac
accgcacccggcggtggccagttcacgctgcctggacgcagcctcatgttcgtccgcaac
gtcggtcacttgatgacgaatgacgccatcgtcgacactgacggcagcgaggtgttcgaa
ggcatcatggatgccctattcaccggcctgatcgccatccacgggctaaaggccagcgac
gtcaacgggccgctgatcaacagccgcaccggctccatctacatcgtcaagccgaagatg
cacggtccggccgaggtggcgtttacctgcgaactgttcagccgggttgaagatgtgctg
gggttgccgcaaaacaccatgaagatcggcatcatggacgaggaacgccggaccacggtc
aacctcaaggcgtgcatcaaagctgccgcggaccgcgtggtgttcatcaacaccgggttc
ctggaccgcaccggcgatgaaatccacacctcgatggaggccggcccgatggtgcgcaag
ggcaccatgaagagccagccgtggatcttggcctacgaagaccacaacgtcgatgccggc
ctggccgccgggttcagcggccgagcccaggtcggcaagggcatgtggacaatgaccgag
ctgatggccgacatggtcgagacaaaaatcgcccagccgcgcgccggggccagcaccgcc
tgggttccctctcccactgcggccaccctgcatgcgctgcactaccaccaggtcgacgtc
gccgcggtgcaacaaggactggcggggaagcgtcgcgccaccatcgaacaattgctgacc
attccgctggccaaggaattggcctgggctcccgacgagatccgcgaagaggtcgacaac
aactgtcaatccatcctcggctacgtggttcgctgggttgatcaaggtgtcggctgctcg
aaggtgcccgacatccacgacgtcgcgctcatggaggaccgggccacgctgcgaatctcc
agccaattgttggccaactggctgcgccacggtgtgatcaccagcgcggatgtgcgggcc
agcttggagcggatggcgccgttggtcgatcgacaaaacgcgggcgacgtggcataccga
ccgatggcacccaacttcgacgacagtatcgccttcctggccgcgcaggagctgatcttg
tccggggcccagcagcccaacggctacaccgagccgatcctgcaccgacgtcgtcgggag
tttaaggcccgggccgctgagaagccggccccatcggacagggccggtgacgatgcggcc
cgctag

DBGET integrated database retrieval system