KEGG   Mycobacterium tuberculosis CCDC5079: CFBS_1959Help
Entry
CFBS_1959         CDS       T02679                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mtur  Mycobacterium tuberculosis CCDC5079
Pathway
mtur00071  Fatty acid degradation
mtur00072  Synthesis and degradation of ketone bodies
mtur00280  Valine, leucine and isoleucine degradation
mtur00310  Lysine degradation
mtur00362  Benzoate degradation
mtur00380  Tryptophan metabolism
mtur00620  Pyruvate metabolism
mtur00630  Glyoxylate and dicarboxylate metabolism
mtur00640  Propanoate metabolism
mtur00650  Butanoate metabolism
mtur00900  Terpenoid backbone biosynthesis
mtur01100  Metabolic pathways
mtur01110  Biosynthesis of secondary metabolites
mtur01120  Microbial metabolism in diverse environments
mtur01130  Biosynthesis of antibiotics
mtur01200  Carbon metabolism
mtur01212  Fatty acid metabolism
mtur02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mtur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CFBS_1959
   00630 Glyoxylate and dicarboxylate metabolism
    CFBS_1959
   00640 Propanoate metabolism
    CFBS_1959
   00650 Butanoate metabolism
    CFBS_1959
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CFBS_1959
   00072 Synthesis and degradation of ketone bodies
    CFBS_1959
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CFBS_1959
   00310 Lysine degradation
    CFBS_1959
   00380 Tryptophan metabolism
    CFBS_1959
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CFBS_1959
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CFBS_1959
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CFBS_1959
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mtur04147]
    CFBS_1959
Enzymes [BR:mtur01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CFBS_1959
Exosome [BR:mtur04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CFBS_1959
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_C
Motif
Other DBs
NCBI-ProteinID: AGM00392
Position
2101042..2102526
Genome map
AA seq 494 aa AA seqDB search
MPVDPRTPVLIGYGQVNHRGDIDAEKQSIEPVDLMAAAARKAADSTVLEAVDSIRVVHML
SAHYRNPGQLLGERIKARTFTTGYSGVGGNMPQSLVNRACLDIQRGRAGVVLLAGAETWR
TRTGLRAKGSKLEWTVQDESVPLPDMAGDDVPMAGAAELRINLDRPAYVYPIFEQALRIA
YGESIENHRKRIGELWARFSAVAADNPHAWIRNPVTADEIWQPGPQNRMVSWPYTKLMNS
NNMVDQGAALLLTSVERATRLRIPAERWVYPQAGTDAHDTPAVADRHRLHRSTAIRIAGA
RALELAGLGLDDIEYVDLYSCFPSAVQVAAIELGLDTDDPARPLTVTGGLTFAGGPWSNY
VTHSIATMAELLAANPGRRGLITANGGYLTKHSFGVYGTEPPSEFRWEDMQPAVDREPTG
DGLVEWEGIGTVEAWTTPVNRDGQPEKAFLAVRTPDGSRSLAVITDPASVQATVREDIAG
VKVAVAPDGTATLR
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgccggtagaccccaggacgccagtgctgatcggctatggacaggtcaaccaccgaggc
gacatcgacgccgagaagcagtccatcgaacccgtcgacctgatggccgccgcggcccgg
aaagccgcggattcgacggtgctcgaggcggtggattcgatccgtgtggtgcacatgctg
tcggcgcattaccggaatcccgggcagctcctcggcgaacgaatcaaggcgaggaccttc
accaccggttacagcggggtgggcggcaacatgccgcaatccctggtcaaccgggcatgc
ctggacatccagcgcgggcgggccggcgtggtgctgctggctggcgccgaaacctggcgc
acccgaacgggcctgcgcgccaagggcagcaaactggagtggactgtgcaggacgaatcc
gttccgctgccggacatggccggcgacgacgttccgatggccggtgcggctgagctgcgg
atcaacctggaccggccggcctacgtgtacccgatattcgagcaggcgctgcgcatcgcc
tacggcgagtcgatcgagaaccaccgaaagcggatcggcgagctgtgggcgcggttcagt
gccgtagctgctgacaacccgcacgcgtggatccgcaacccggttacggctgacgagatc
tggcagcccggcccacagaaccggatggtcagctggccctacaccaagcttatgaactcc
aacaacatggttgaccagggtgccgcgctgctgctgacgtcggtcgaacgtgcgacacgt
ctgcgaataccggccgaacgctgggtttatccacaggctggcaccgacgcccacgacaca
ccggccgtcgccgaccgccaccgactgcatcggtcgacggccattcggatcgccggtgcc
cgggcgctggaactggctgggctggggctcgatgacatcgaatacgtcgacctgtattcg
tgctttccctccgctgtccaagtcgccgcaatcgaactcggcctggacaccgacgatcct
gcccgcccgctgaccgtcaccgggggcctgaccttcgccggcgggccgtggagcaattac
gtcacgcactccatcgccaccatggctgaactgctggcggccaatcccgggcgccgaggt
ctgatcaccgccaacggcggttacctgaccaaacacagtttcggggtctacggcaccgag
ccgccgtcggaattccgctgggaggacatgcaacccgcggtcgatagggagcccaccgga
gatgggttggtcgagtgggaaggcatcggcaccgtcgaagcgtggaccacaccagtcaac
cgggacggacaacccgagaaggcgttcctggcggtgcgcacgcccgacgggtcgcgcagc
ttggccgtgatcaccgatcccgcatcggtgcaagcaacggtgcgcgaggacatcgccggc
gtcaaggttgccgtcgcccccgacggcaccgcgaccctgcgatag

DBGET integrated database retrieval system