KEGG   Mycobacterium tuberculosis CCDC5079: CFBS_3586Help
Entry
CFBS_3586         CDS       T02679                                 

Definition
(GenBank) C-terminal truncated polyprenyl synthetase IdsB
  KO
K13787  geranylgeranyl diphosphate synthase, type I [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
mtur  Mycobacterium tuberculosis CCDC5079
Pathway
mtur00900  Terpenoid backbone biosynthesis
mtur01100  Metabolic pathways
mtur01110  Biosynthesis of secondary metabolites
mtur01130  Biosynthesis of antibiotics
Module
mtur_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:mtur00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CFBS_3586
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:mtur01006]
    CFBS_3586
Enzymes [BR:mtur01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     CFBS_3586
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     CFBS_3586
    2.5.1.29  geranylgeranyl diphosphate synthase
     CFBS_3586
Prenyltransferases [BR:mtur01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   CFBS_3586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: AGM02019
Position
complement(3796167..3796847)
Genome map
AA seq 226 aa AA seqDB search
MGGVLTLDAAFLGSVPADLGKALLERARADCGPVLHRAIESMREPLATMAGYHLGWWNAD
RSTAAGSSGKYFRAALVYAAAAACGGDVGDATPVSAAVELVHNFTLLHDDVMDGDATRRG
RPTVWSVWGVGGAILLGDALHATAVRILTGLTDECVAVRAIRRLQMSCLDLCIGQFEDCL
LEGQPEVTVDDYLRMAAGKTAALTGCCCALGALVANADDATIEPPR
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgggaggcgtattgactctggatgcggcttttctggggagtgtccctgctgaccttggg
aaagcattgttagaacgggctcgagcggattgtggccctgtgctgcatcgggccattgag
tcgatgcgcgagccgttggcgacgatggcgggatatcaccttggctggtggaacgccgat
cgatccacagcggcaggatcgtcgggcaagtattttcgcgccgcccttgtctacgcggcg
gccgcggcttgcggtggtgatgtcggtgatgctactccggtgtcggcggctgtggagttg
gtgcacaacttcacgttgttgcatgacgatgtgatggatggggatgcgactcgcagggga
cggccgacggtatggagtgtgtggggtgtgggcggcgcgatcctgttgggagatgcgttg
cacgccacggccgttcggatactgaccggcctgaccgacgagtgtgtggcggtcagggcg
ataaggcgattgcagatgtcgtgcctggacttgtgtatcggccagtttgaggattgttta
ttggagggacagcccgaagttacagtcgatgactatctgcggatggccgcgggcaagacg
gccgccctgaccggttgttgttgcgctctgggagctttagtggccaatgcagacgacgcg
acgattgaaccgccccggtga

DBGET integrated database retrieval system