KEGG   Mycobacterium tuberculosis CCDC5079: CFBS_3762Help
Entry
CFBS_3762         CDS       T02679                                 

Gene name
fadA5
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mtur  Mycobacterium tuberculosis CCDC5079
Pathway
mtur00071  Fatty acid degradation
mtur00072  Synthesis and degradation of ketone bodies
mtur00280  Valine, leucine and isoleucine degradation
mtur00310  Lysine degradation
mtur00362  Benzoate degradation
mtur00380  Tryptophan metabolism
mtur00620  Pyruvate metabolism
mtur00630  Glyoxylate and dicarboxylate metabolism
mtur00640  Propanoate metabolism
mtur00650  Butanoate metabolism
mtur00900  Terpenoid backbone biosynthesis
mtur01100  Metabolic pathways
mtur01110  Biosynthesis of secondary metabolites
mtur01120  Microbial metabolism in diverse environments
mtur01130  Biosynthesis of antibiotics
mtur01200  Carbon metabolism
mtur01212  Fatty acid metabolism
mtur02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mtur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CFBS_3762 (fadA5)
   00630 Glyoxylate and dicarboxylate metabolism
    CFBS_3762 (fadA5)
   00640 Propanoate metabolism
    CFBS_3762 (fadA5)
   00650 Butanoate metabolism
    CFBS_3762 (fadA5)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CFBS_3762 (fadA5)
   00072 Synthesis and degradation of ketone bodies
    CFBS_3762 (fadA5)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CFBS_3762 (fadA5)
   00310 Lysine degradation
    CFBS_3762 (fadA5)
   00380 Tryptophan metabolism
    CFBS_3762 (fadA5)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CFBS_3762 (fadA5)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CFBS_3762 (fadA5)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CFBS_3762 (fadA5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mtur04147]
    CFBS_3762 (fadA5)
Enzymes [BR:mtur01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CFBS_3762 (fadA5)
Exosome [BR:mtur04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CFBS_3762 (fadA5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AGM02195
Structure
PDB: 

Position
3987657..3988832
Genome map
AA seq 391 aa AA seqDB search
MGYPVIVEATRSPIGKRNGWLSGLHATELLGAVQKAVVDKAGIQSGLHAGDVEQVIGGCV
TQFGEQSNNISRVAWLTAGLPEHVGATTVDCQCGSGQQANHLIAGLIAAGAIDVGIACGI
EAMSRVGLGANAGPDRSLIRAQSWDIDLPNQFEAAERIAKRRGITREDVDVFGLESQRRA
QRAWAEGRFDREISPIQAPVLDEQNQPTGERRLVFRDQGLRETTMAGLGELKPVLEGGIH
TAGTSSQISDGAAAVLWMDEAVARAHGLTPRARIVAQALVGAEPYYHLDGPVQSTAKVLE
KAGMKIGDIDIVEINEAFASVVLSWARVHEPDMDRVNVNGGAIALGHPVGCTGSRLITTA
LHELERTDQSLALITMCAGGALSTGTIIERI
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgggttacccggtcatcgttgaagccacccgcagccccatcggcaaacgcaacggatgg
ctgtcggggctgcatgccaccgagttgttgggcgcggtgcaaaaggcggtggtcgacaag
gccggcatccagtccggccttcacgccggtgacgtcgaacaggtcatcggcggttgcgtg
acccagttcggggagcaatccaacaacatcagccgggtggcctggctgacggccggtttg
cccgaacacgtcggcgccaccaccgtcgactgccagtgcggcagcggccagcaggccaac
catctgattgccgggttgatcgcggccggtgccatcgatgtcggcatcgcctgcggcatc
gaggcgatgagccgggtcgggctgggcgccaacgccgggccggaccgctcgctgatccgc
gcgcagtcatgggatatcgacctgccgaaccagttcgaggccgccgagcggatcgccaag
cggcgcggcatcacccgcgaggacgtggatgtcttcgggctcgagtcgcagcgacgcgcg
cagcgggcctgggcggagggccgctttgaccgcgagatctcgccgatccaggcgccggtg
ctcgacgagcagaatcagcccaccggcgagcggcgcctggtctttcgcgaccagggcctg
cgcgagaccacgatggcggggctaggcgagctgaaaccggtgctcgagggcggcatccac
accgcgggcacgtcgtcgcagatctccgacggcgcggcagccgtgttgtggatggacgaa
gccgtggcacgtgcgcacggcctgaccccgcgggcccggatcgtcgcccaggcactcgtc
ggcgccgagccctactaccacctggacggcccggtgcagtccaccgcgaaggtgctggag
aaggccggcatgaagatcggcgacatcgacatcgtcgagatcaacgaggcgttcgcgtcc
gtggtgctgtcctgggcgcgggtgcacgagcccgacatggaccgggtcaacgtcaacggc
ggggcgatcgcgctggggcatccggtgggctgcaccggcagccggctgatcaccaccgcc
ctgcacgagctcgagcgcaccgaccagagcctcgcgctgatcaccatgtgcgccggcggg
gccctgtccaccggcaccatcatcgagcggatttaa

DBGET integrated database retrieval system