KEGG   Mycobacterium tuberculosis BT1: HKBT1_0037Help
Entry
HKBT1_0037        CDS       T03152                                 

Gene name
bioF2
Definition
(GenBank) putative 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
mtut  Mycobacterium tuberculosis BT1
Pathway
mtut00780  Biotin metabolism
mtut01100  Metabolic pathways
Module
mtut_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:mtut00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    HKBT1_0037 (bioF2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mtut01007]
    HKBT1_0037 (bioF2)
Enzymes [BR:mtut01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     HKBT1_0037 (bioF2)
Amino acid related enzymes [BR:mtut01007]
 Aminotransferase (transaminase)
  Class II
   HKBT1_0037 (bioF2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Acetyltransf_6 Beta_elim_lyase Cys_Met_Meta_PP DegT_DnrJ_EryC1 Aminotran_5 OKR_DC_1 FemAB_like
Motif
Other DBs
NCBI-ProteinID: AHJ48983
Position
35634..37949
Genome map
AA seq 771 aa AA seqDB search
MPTGFGYDFLRPVEDSGINDLKHYYFMADLADGQPLGRANLYSVCFDLATTDRKLTPAWR
TTIKRWFPGFMTFRFLECGLLTMVSNPLALRSDTDLERVLPVLAGQMDQLAHDDGSDFLM
IRDVDPEHYQRYLDILRPLGFRPALGFSRVDTTISWSSVEEALGCLSHKRRLPLKTSLEF
RERFGIEVEELDEYAEHAPVLARLWRNVKTEAKDYQREDLNPEFFAACSRHLHGRSRLWL
FRYQGTPIAFFLNVWGADENYILLEWGIDRDFEHYRKANLYRAALMLSLKDAISRDKRRM
EMGITNYFTKLRIPGARVIPTIYFLRHSTDPVHTATLARMMMHNIQRPTLPDDMSEEFCR
WEERIRLDQDGLPEHDIFRKIDRQHKYTGLKLGGVYGFYPRFTGPQRSTVKAAELGEIVL
LGTNSYLGLATHPEVVEASAEATRRYGTGCSGSPLLNGTLDLHVSLEQELACFLGKPAAV
LCSTGYQSNLAAISALCESGDMIIQDALNHRSLFDAARLSGADFTLYRHNDMDHLARVLR
RTEGRRRIIVVDAVFSMEGTVADLATIAELAHRHGCRVYVDESHALGVLGPDGRGASAAL
GVLARMDVVMGTFSKSFASVGGFIAGDRPVVDYIRHNGSGHVFSASLPPAAAAATHAALR
VSRREPDRRARVLAAAEYMATGLARQGYQAEYHGTAIVPVILGNPTVAHAGYLRLMRSGV
YVNPVAPPAVPEERSGFRTSYLADHRQSDLDRALHVFAGLAEDLTPQGAAL
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
atgcccactggcttcggctatgactttctgcgccctgtcgaggactcggggatcaacgac
ctgaagcactattacttcatggcggatttggccgatgggcaaccgctaggccgggcaaac
ctctatagcgtctgtttcgacctggccaccaccgaccgcaagctcactccggcctggcga
acgaccatcaaacggtggtttccggggtttatgaccttccgtttcctcgagtgcgggttg
ctcaccatggtgagcaacccgctggcgttgcggtccgacaccgacttggagcgggtattg
cctgtgctggccggccagatggaccagttggcgcatgacgacgggtcggatttcttgatg
atccgggacgtggacccggaacactaccagcgataccttgacatcctgcgcccgttgggc
tttcggcctgcgctgggcttttcccgggtagacacgaccatcagctggtcgagcgtggaa
gaggcactgggctgcctgtctcacaaaaggcgcctgccgttgaagacgtcgctggagttt
cgtgagcggttcggtatcgaggtcgaggaactcgacgagtatgccgagcatgcgccggta
ttggcccggctttggcgcaacgtcaagacggaggcaaaggattaccagcgcgaggacctg
aaccctgagttcttcgcggcgtgttctcggcatctgcatggacgtagcagactgtggttg
ttccgctaccagggcacgccaattgccttctttttgaacgtttggggtgcggatgagaac
tacatactgcttgagtggggcatcgatcgtgattttgaacattataggaaggcgaatctg
taccgggcggcgctgatgctcagcctaaaagatgcgatcagccgagataaacggcgaatg
gaaatgggtattacgaactatttcacaaaacttcgcattccgggtgcccgagtcataccg
accatctatttcctgcgtcacagcacggatccggtgcatacggcaacgttagcgcgaatg
atgatgcacaatattcaacggccaacgctacccgacgatatgtcggaggaattctgtcgc
tgggaagagcgaatacgtctggaccaggacgggctacccgaacacgatatctttcgcaag
atcgatcgtcagcacaaatacacggggctcaaactcggcggagtctacggtttttatccc
cgattcaccggaccgcagcgatccacggtcaaggccgcggagctgggcgagatcgtgttg
ctgggcacgaactcgtatctgggcctggccacccatccagaggtggtggaggcttcggcg
gaggccacgcgacggtacggcaccggctgctcgggttcgccgttgctgaacggcacgttg
gacttgcacgtctcgcttgagcaggaactagcctgttttttgggcaaacccgccgccgtg
ttgtgctccaccggatatcagagcaacctggcggcgatcagcgcgctatgcgaatccggg
gacatgatcatccaagacgcgctgaaccaccgcagcctgttcgacgccgccaggttgtcc
ggggccgacttcaccttgtaccggcacaacgacatggaccacctggcgcgggtgctacgc
cgcaccgaggggcgccgccggatcatcgtcgtggacgcggtgttcagcatggaaggcacc
gtcgccgacctggccaccatcgccgagcttgcccaccggcacggctgccgggtctatgtg
gacgagtcccatgcgctgggcgtgctcggccccgacgggcgaggagcttcggccgcgttg
ggtgtcttggcgcgcatggacgtggtgatgggcacgttcagcaaatcctttgcctccgtc
ggcgggttcatcgccggagatcggcccgtcgtggactacatccggcacaacggttcaggt
catgtgttttccgccagcctgccgccggccgccgcggctgccacccacgcggctctgcgc
gtcagtcggcgtgaacccgaccggcgggctcgggtgctggccgcggccgagtacatggcc
accggcctggcacggcagggctatcaggccgagtatcacggaaccgcgatcgtgccggtg
atcctgggcaacccgaccgtggcgcatgcgggctatctgcggctgatgcgctccggggtg
tatgtgaacccggtggcccccccagccgtgccggaggagcgttcgggattccgcaccagc
tacctagccgaccaccgacaatctgacctcgaccgggccttgcacgtgtttgccggcctt
gccgaggacctgaccccgcaaggagccgcgctatga

DBGET integrated database retrieval system