KEGG   Mycobacterium tuberculosis BT1: HKBT1_0500Help
Entry
HKBT1_0500        CDS       T03152                                 

Definition
(GenBank) amidohydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
mtut  Mycobacterium tuberculosis BT1
Brite
KEGG Orthology (KO) [BR:mtut00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HKBT1_0500
Enzymes [BR:mtut01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     HKBT1_0500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: AHJ49446
Position
complement(567340..568182)
Genome map
AA seq 280 aa AA seqDB search
MRIALAQIRSGTDPAANLQLVGKYAGEAATAGAQLVVFPEATMCRLGVPLRQVAEPVDGP
WANGVRRIATEAGITVIAGMFTPTGDGRVTNTLIAAGPGTPNQPDAHYHKIHLYDAFGFT
ESRTVAPGREPVVVVVDGVRVGLTVCYDIRFPALYTELARRGAQLIAVCASWGSGPGKLE
QWTLLARARALDSMSYVAAAGQADPGDARTGVGASSAAPTGVGGSLVASPLGEVVVSAGT
QPQLLVADIDVDNVAAARDRIAVLRNQTDFVQIDKAQSRG
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatcgcgttggcgcaaatccgcagcggtaccgaccccgccgccaatctgcaactg
gtcggcaagtacgccggcgaagccgccaccgcgggcgcacagctggtggtgtttcctgag
gcgaccatgtgccggctcggtgtcccgctgcggcaggtcgccgagcccgtcgacggaccc
tgggcaaacggagtccgacggatcgcgaccgaggcgggcatcaccgtgatcgccggcatg
ttcaccccgaccggcgacgggcgggtaacaaacacgctgatcgcagccggcccgggcacg
cccaatcagccggacgcgcactaccacaagatccacctctatgacgcgttcggcttcacc
gagtcacgtaccgtcgcacccgggcgcgaaccggtggtagtcgtggtcgacggcgtgcgg
gtgggtttgaccgtttgctacgacattcgctttcccgccctttataccgagctggcgcgg
cgcggggcccaactgatcgcggtctgtgcatcctggggttccggtccgggcaaactcgaa
cagtggacgttgctggcccgcgcccgggcgctagactccatgagttacgtcgccgcggcc
ggccaagcagacccaggtgatgcccgcaccggcgtgggggcgagctcggctgcaccgacc
ggggtaggcggcagcctggtggcctcgccgctaggcgaggtggtggtgtcagctggcacc
cagccgcaactgctggtcgccgacatcgatgtcgacaatgtggccgcggctcgcgaccgc
attgcggtgctacgcaaccagacagacttcgttcagatcgataaggcacaatcgcgtggg
tga

DBGET integrated database retrieval system