KEGG   Mycobacterium tuberculosis BT1: HKBT1_0742Help
Entry
HKBT1_0742        CDS       T03152                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
mtut  Mycobacterium tuberculosis BT1
Pathway
mtut03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mtut00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    HKBT1_0742 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mtut03011]
    HKBT1_0742 (rplV)
Ribosome [BR:mtut03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    HKBT1_0742 (rplV)
  Bacteria
    HKBT1_0742 (rplV)
  Archaea
    HKBT1_0742 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AHJ49688
Structure
PDB: 

Position
802890..803483
Genome map
AA seq 197 aa AA seqDB search
MTAATKATEYPSAVAKARFVRVSPRKARRVIDLVRGRSVSDALDILRWAPQAASGPVAKV
IASAAANAQNNGGLDPATLVVATVYADQGPTAKRIRPRAQGRAFRIRRRTSHITVVVESR
PAKDQRSAKSSRARRTEASKAASKVGATAPAKKAAAKAPAKKAPASSGVKKTPAKKAPAK
KAPAKASETSAAKGGSD
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgactgcggctactaaggctaccgagtatccctcggcggtcgccaaggcccgatttgtg
cgggtgtcgccaagaaaggcgcgccgggtgatcgatctggtgcgtggcaggtcggtgtca
gacgcgctcgacatcctgcgctgggcgccgcaggccgccagcggtccggtggccaaagtg
atcgccagtgcggcggccaacgcgcaaaacaacggcgggctggacccggcaaccttggtg
gtggccaccgtgtacgccgaccagggaccgaccgccaagcgcatccgtccgcgcgcccag
ggccgcgcgttccgcatccgccggcgcactagccacatcacggtggtggtggaaagccgg
ccggccaaagatcaacggtcggcgaaatcgtcgcgggcccgccgcaccgaggccagcaag
gccgccagcaaggtcggggctacggcgccggccaagaaagcggccgccaaagcgcccgcc
aagaaggcacccgccagttccggcgttaagaagacacccgcaaagaaagcgcccgccaag
aaggcgcccgccaaggcttctgagacttctgcagcgaagggaggctcagactag

DBGET integrated database retrieval system