KEGG   Mycobacterium tuberculosis BT1: HKBT1_0975Help
Entry
HKBT1_0975        CDS       T03152                                 

Definition
(GenBank) short-chain type dehydrogenase/reductase
  KO
K00076  7-alpha-hydroxysteroid dehydrogenase [EC:1.1.1.159]
Organism
mtut  Mycobacterium tuberculosis BT1
Pathway
mtut00121  Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:mtut00001]
 09100 Metabolism
  09103 Lipid metabolism
   00121 Secondary bile acid biosynthesis
    HKBT1_0975
Enzymes [BR:mtut01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.159  7alpha-hydroxysteroid dehydrogenase
     HKBT1_0975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR 3HCDH_N NAD_binding_7 Sacchrp_dh_NADP Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: AHJ49921
Position
complement(1032589..1033377)
Genome map
AA seq 262 aa AA seqDB search
MILDMFRLDDKVAVITGGGRGLGAAIALAFAQAGADVLIASRTSSELDAVAEQIRAAGRR
AHTVAADLAHPEVTAQLAGQAVGAFGKLDIVVNNVGGTMPNTLLSTSTKDLADAFAFNVG
TAHALTVAAVPLMLEHSGGGVINISSTMGRLAARGFAAYGTAKAALAHYTRLAALDLCPR
VRVNAIAPGSILTSALEVVAANDELRAPMEQATPLRRLGDPVDIAAAAVYLASPAGSFLT
GKTLEVDGGLTFPNLDLPIPDL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgatcctggatatgttccgtcttgacgacaaggttgccgtcatcaccggcggcggccgc
ggcctgggagcagccatcgcattggctttcgcccaggccggcgcggatgtcctcatcgct
tcacgaacatcatccgagcttgacgctgtcgccgaacagatccgcgctgccggccgccgc
gcccacaccgttgccgccgatctggcccatcccgaggtgaccgcgcagctggctggtcag
gccgtcggagctttcgggaagctcgacatcgtcgtcaacaacgttggcggcaccatgccc
aacacgctgctaagcacctcgaccaaggacctcgcggacgccttcgccttcaacgtgggc
accgcccacgcgctgaccgtcgcggcggtgccgttgatgctggaacactccggcggcggc
gtgatcaacatcagctccaccatgggccggctggcggcgcggggtttcgccgcctacggc
accgccaaggccgcactggcccactacacccggctggcggcgctggacctgtgcccacgc
gtccgggtcaatgcgatcgcgccgggttccatcctgacctcggcgctggaggtggtagcc
gccaacgacgagctgcgtgcgccgatggagcaggcgacaccactgcgccggctcggtgac
cccgtcgacattgcagctgcggcagtgtatttggcctctccggcgggcagcttcctgacc
ggcaagacgttggaggtcgacggcggactcaccttccccaatctcgaccttcccattccg
gacctgtga

DBGET integrated database retrieval system