KEGG   Mycobacterium tuberculosis BT1: HKBT1_1207Help
Entry
HKBT1_1207        CDS       T03152                                 

Definition
(GenBank) putative acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mtut  Mycobacterium tuberculosis BT1
Pathway
mtut00071  Fatty acid degradation
mtut00072  Synthesis and degradation of ketone bodies
mtut00280  Valine, leucine and isoleucine degradation
mtut00310  Lysine degradation
mtut00362  Benzoate degradation
mtut00380  Tryptophan metabolism
mtut00620  Pyruvate metabolism
mtut00630  Glyoxylate and dicarboxylate metabolism
mtut00640  Propanoate metabolism
mtut00650  Butanoate metabolism
mtut00900  Terpenoid backbone biosynthesis
mtut01100  Metabolic pathways
mtut01110  Biosynthesis of secondary metabolites
mtut01120  Microbial metabolism in diverse environments
mtut01130  Biosynthesis of antibiotics
mtut01200  Carbon metabolism
mtut01212  Fatty acid metabolism
mtut02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mtut00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HKBT1_1207
   00630 Glyoxylate and dicarboxylate metabolism
    HKBT1_1207
   00640 Propanoate metabolism
    HKBT1_1207
   00650 Butanoate metabolism
    HKBT1_1207
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HKBT1_1207
   00072 Synthesis and degradation of ketone bodies
    HKBT1_1207
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HKBT1_1207
   00310 Lysine degradation
    HKBT1_1207
   00380 Tryptophan metabolism
    HKBT1_1207
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HKBT1_1207
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HKBT1_1207
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HKBT1_1207
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mtut04147]
    HKBT1_1207
Enzymes [BR:mtut01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HKBT1_1207
Exosome [BR:mtut04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HKBT1_1207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_C
Motif
Other DBs
NCBI-ProteinID: AHJ50153
Position
1263246..1263488
Genome map
AA seq 80 aa AA seqDB search
MQLGNQNTMRFAGRPQRFRQSAYPLFNPNSAIALGHPFGGSGARLMTTVLHHMPDKGIRY
GLQTMCEGRGQANATIVELL
NT seq 243 nt NT seq  +upstreamnt  +downstreamnt
atgcagcttggcaatcaaaacactatgagattcgcagggcggcctcagcgttttcgccaa
agcgcttaccccctgttcaaccccaacagcgcgatcgcgcttggccacccattcggcggc
tcgggggcacggttgatgactacagtgctacaccacatgccggacaagggaattcgctac
ggcttacagacgatgtgcgagggccgcggccaagccaatgccaccattgtggagttgctg
tga

DBGET integrated database retrieval system