KEGG   Mycobacterium tuberculosis BT1: HKBT1_2403Help
Entry
HKBT1_2403        CDS       T03152                                 

Gene name
pitB
Definition
(GenBank) putative phosphate-transport permease PitB
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
mtut  Mycobacterium tuberculosis BT1
Brite
KEGG Orthology (KO) [BR:mtut00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    HKBT1_2403 (pitB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AHJ51349
Position
2544544..2546202
Genome map
AA seq 552 aa AA seqDB search
MSDNAKHHRDGHLVASGLQDRAARTPQHEGFLGPDRPWHLSFSLLLAGSFVLFSWWAFDY
AGSGANKVILVLATVVGMFMAFNVGGNDVANSFGTSVGAGTLTMKQALLVAAIFEVSGAV
IAGGDVTETIRSGIVDLSGVSVDPRDFMNIMLSALSAAALWLLFANRMGYPVSTTHSIIG
GIVGAAIALGMVSGQGGAALRMVQWDQIGQIVVSWVLSPVLGGLVSYLLYGVIKRHILLY
NEQAERRLTEIKKERIAHRERHKAAFDRLTEIQQIAYTGALARDAVAANRKDFDPDELES
DYYRELHEIDAKTSSVDAFRALQNWVPLVAAAGSMIIVAMLLFKGFKHMHLGLTTMNNYF
IIAMVGAAVWMATFIFAKTLRGESLSRSTFLMFSWMQVFTASGFAFSHGSNDIANAIGPF
AAILDVLRTGAIEGNAAVPAAAMVTFGVALCAGLWFIGRRVIATVGHNLTTMHPASGFAA
ELSAAGVVMGATVLGLPVSSTHILIGAVLGVGIVNRSTNWGLMKPIVLAWVITLPSAAIL
ASVGLVALRAIF
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacaatgccaaacaccacagggatgggcatttggtggctagcggacttcaggat
cgcgcagcgcgcacaccgcaacacgagggcttcctcgggccggaccgaccatggcacctg
tcgttcagtctgctgctggcgggttctttcgtgctgttctcgtggtgggcattcgactac
gcagggtccggcgcgaacaaagtcatcctggtgctcgccaccgtcgtcggcatgttcatg
gccttcaacgtcggcggcaatgatgtcgccaactcgtttggcaccagcgtcggcgcgggc
acgttgaccatgaaacaggcgcttctggtcgcggcgatcttcgaggtcagcggcgcggtg
atcgccggcggcgacgtcaccgagaccatccgcagcggcatcgttgatctgtccggggtg
tccgtcgacccacgcgacttcatgaacatcatgctgtcggcgctatcggcagccgcgctc
tggctgctgtttgctaaccgtatggggtacccggtgtcgaccacacactcgatcatcggc
ggcatcgtcggcgcggcgatcgcgctggggatggtgagcggccagggcggtgccgcactc
aggatggtccagtgggatcaaatcggccagatcgtggtgtcctgggtgctgtcgccggtg
ttgggcggcttggtgtcgtacctgctctacggcgtcatcaaacggcacatcctgctgtac
aacgaacaggccgaacgacggctaacagaaattaagaaagagcgcatcgcacaccgcgag
cgccacaaggcggcgttcgaccggctcaccgagatccagcagatcgcctataccggcgcc
ctggcgcgcgacgccgtcgcggcaaaccgcaaggactttgatcccgacgaactggaatcc
gattactaccgcgagctacacgaaatcgacgccaagacatcgtcggtcgacgcgttccgg
gccctgcagaactgggttccgctggtcgccgccgccggatccatgatcattgtcgcgatg
ctgctgttcaaggggttcaagcacatgcacttgggccttaccacgatgaataactacttc
atcatcgcgatggtcggtgcagcggtgtggatggccacctttattttcgccaagacactt
cggggcgaatcactttcacggtcaacgtttttgatgttcagctggatgcaggtctttacg
gcctcgggcttcgccttcagccacggcagcaatgacattgccaacgccatcgggccgttc
gcggcaatcctggatgtgctgcgcacgggcgccattgaaggcaacgcagcggtgcctgcc
gcggccatggtaacgttcggcgtcgcgttgtgcgcggggttgtggttcattggacgacgg
gtgatcgccaccgttggacacaacctcaccacgatgcacccggcatcggggtttgctgcc
gaattgtcggccgccggggtggtcatgggagccacggtcctgggtcttccggtttccagc
acgcacattcttatcggcgccgtcctcggcgtcggcatcgtaaaccggtccaccaactgg
ggactgatgaaaccgatcgtgctagcgtgggtcatcacgctgccttcggcggcgatcctc
gcctcggtcggtcttgtcgcgctacgcgcgattttctga

DBGET integrated database retrieval system