KEGG   Mycobacterium tuberculosis BT1: HKBT1_3735Help
Entry
HKBT1_3735        CDS       T03152                                 

Definition
(GenBank) 4-hydroxy-2-oxovalerate aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
mtut  Mycobacterium tuberculosis BT1
Pathway
mtut00360  Phenylalanine metabolism
mtut00362  Benzoate degradation
mtut00621  Dioxin degradation
mtut00622  Xylene degradation
mtut01100  Metabolic pathways
mtut01120  Microbial metabolism in diverse environments
mtut01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mtut00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    HKBT1_3735
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HKBT1_3735
   00622 Xylene degradation
    HKBT1_3735
   00621 Dioxin degradation
    HKBT1_3735
Enzymes [BR:mtut01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     HKBT1_3735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm
Motif
Other DBs
NCBI-ProteinID: AHJ52681
Structure
PDB: 

Position
complement(3960394..3961434)
Genome map
AA seq 346 aa AA seqDB search
MTDMWDVRITDTSLRDGSHHKRHQFTKDEVGAIVAALDAAGVPVIEVTHGDGLGGSSFNY
GFSKTPEQELIKLAAATAKEARIAFLMLPGVGTKDDIKEARDNGGSICRIATHCTEADVS
IQHFGLARELGLETVGFLMMAHTIAPEKLAAQARIMADAGCQCVYVVDSAGALVLDGVAD
RVSALVAELGEDAQVGFHGHENLGLGVANSVAAVRAGAKQIDGSCRRFGAGAGNAPVEAL
IGVFDKIGVKTGIDFFDIADAAEDVVRPAMPAECLLDRNALIMGYSGVYSSFLKHAVRQA
ERYGVPASALLHRAGQRKLIGGQEDQLIDIALEIKRELDSGAAVTH
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatatgtgggacgtccgcatcacggacacctcgctgcgggatgggtcgcaccac
aaacgccaccaattcaccaaggacgaggtcggtgccatcgtggccgccctagacgccgct
ggcgtgccggtgatcgaggtgacccacggcgacggcctgggcggctcatcgttcaactat
ggcttctcgaaaacccctgagcaggagctgatcaagctggccgcggcgaccgcgaaagag
gcccggatcgcgtttttgatgttgcccggtgtgggcaccaaggacgacatcaaagaggcg
cgggacaacggcgggtcgatctgccggatcgccacccactgcaccgaggccgacgtgtcg
atccagcatttcgggctggcccgcgaactgggtctggaaaccgtcgggtttttgatgatg
gcccacaccattgcgccggagaaactggccgcccaggcccgcatcatggccgacgccggc
tgccagtgtgtctacgtcgtcgactccgccggtgccctggtgctcgacggcgtggccgac
cgggtgtcggccctggtcgccgagctcggcgaagacgcccaggtgggctttcatgggcac
gagaacctcggtctcggggtggccaattcggtggcggcggtgcgcgcgggcgccaagcag
atcgacgggtcctgccggcgtttcggcgccggggcgggtaacgcgccggtcgaggcgctg
atcggggtgttcgacaagatcggcgtcaagaccggcattgatttcttcgacattgccgac
gccgccgaggacgtggtgcgcccggccatgccggccgaatgtctgctcgaccgcaacgcg
ttgatcatggggtattccggggtctactccagcttcctcaagcatgcggtccgccaggcc
gagcgctacggcgtgccggcgtcggcgctgttgcaccgggccggtcagcgcaagctcatc
ggtggccaggaagaccagctcatcgacatcgcgctggaaatcaaacgcgagctggatagc
ggtgcggccgtaacgcattga

DBGET integrated database retrieval system