KEGG   Mycobacterium tuberculosis BT2: HKBT2_2910Help
Entry
HKBT2_2910        CDS       T03153                                 

Gene name
dfrA
Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
mtuu  Mycobacterium tuberculosis BT2
Pathway
mtuu00670  One carbon pool by folate
mtuu00790  Folate biosynthesis
mtuu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtuu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HKBT2_2910 (dfrA)
   00670 One carbon pool by folate
    HKBT2_2910 (dfrA)
Enzymes [BR:mtuu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     HKBT2_2910 (dfrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: AHJ47707
Structure
PDB: 

Position
complement(3054427..3054912)
Genome map
AA seq 161 aa AA seqDB search
MTMVGLIWAQATSGVIGRGGDIPWRLPEDQAHFREITMGHTIVMGRRTWDSLPAKVRPLP
GRRNVVLSRQADFMASGAEVVGSLEEALTSPETWVIGGGQVYALALPYATRCEVTEVDIG
LPREAGDALAPVLDETWRGETGEWRFSRSGLRYRLYSYHRS
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
gtgacgatggtggggctgatctgggctcaagcgacatcgggtgtcatcggccgcggcggc
gacatcccctggcgcttgcccgaggaccaggcgcatttccgggagatcaccatggggcac
acgatcgtgatgggccggcgcacatgggattcgctgccggctaaagtccggccgctgccc
ggccggcgaaatgtcgtactgagccgccaagctgactttatggccagcggggctgaggtt
gtcggttcactcgaggaggcgctgaccagcccggagacgtgggtgatcggaggcggacaa
gtctatgcgctggcgctgccgtacgcgaccagatgtgaggttaccgaggtcgacatcggc
ctgccgcgcgaagccggtgacgcgctggcccccgtgctggacgagacatggcggggcgag
acgggggagtggcgcttcagccggtccgggttgcggtaccggttgtacagctaccaccgc
tcatga

DBGET integrated database retrieval system