KEGG   Mycobacterium tuberculosis BT2: HKBT2_3191Help
Entry
HKBT2_3191        CDS       T03153                                 

Definition
(GenBank) glycosyl transferase
  KO
K16150  glycogen synthase [EC:2.4.1.11]
Organism
mtuu  Mycobacterium tuberculosis BT2
Pathway
mtuu00500  Starch and sucrose metabolism
mtuu01100  Metabolic pathways
Module
mtuu_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:mtuu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HKBT2_3191
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mtuu01003]
    HKBT2_3191
Enzymes [BR:mtuu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     HKBT2_3191
Glycosyltransferases [BR:mtuu01003]
 Polysaccharide
  Storage polysaccharide
   HKBT2_3191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_1 Glyco_transf_4 Glyco_trans_1_4 Glyco_trans_4_4 Glyco_transf_5 Glyco_trans_1_2 Glycogen_syn Glyco_trans_4_2
Motif
Other DBs
NCBI-ProteinID: AHJ47988
Position
3369557..3370789
Genome map
AA seq 410 aa AA seqDB search
MVSWEYPPVVIGGLGRHVHHLSTALAAAGHDVVVLSRCPSGTDPSTHPSSDEVTEGVRVI
AAAQDPHEFTFGNDMMAWTLAMGHAMIRAGLRLKKLGTDRSWRPDVVHAHDWLVAHPAIA
LAQFYDVPMVSTIHATEAGRHSGWVSGALSRQVHAVESWLVRESDSLITCSASMNDEITE
LFGPGLAEITVIRNGIDAARWPFAARRPRTGPAELLYVGRLEYEKGVHDAIAALPRLRRT
HPGTTLTIAGEGTQQDWLIDQARKHRVLRATRFVGHLDHTELLALLHRADAAVLPSHYEP
FGLVALEAAAAGTPLVTSNIGGLGEAVINGQTGVSCAPRDVAGLAAAVRSVLDDPAAAQR
RARAARQRLTSDFDWQTVATATAQVYLAAKRGERQPQPRLPIVEHALPDR
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcgtgggagtacccgccggtggtgatcggcggactcggccgccacgtgcatcat
ctgtcgaccgcgctagccgcagccggtcacgatgtcgtcgtgttgtcccggtgtccgtcg
ggcaccgatcccagcacacacccatcctccgatgaggtgaccgaaggggtccgggtgatt
gcggccgcgcaggacccgcacgagttcacgtttggcaacgacatgatggcctggaccctg
gcgatgggccacgccatgatccgcgccgggctgcgcttgaagaaacttggcaccgaccgc
tcgtggcgtcctgacgtcgtgcacgcacacgactggctggtggcccatccggccatcgcc
cttgcccagttctatgacgtgccaatggtttccacgattcatgcaacggaggccggtcga
cattccggctgggtctccggagctctcagccgtcaggtgcacgcggtcgagtcgtggctg
gtgcgtgaatccgattcgctgatcacatgctcggcgtcgatgaacgacgagatcaccgag
ctgttcgggcccgggctggccgagatcaccgtgatccgtaacggcattgacgcggcgcgc
tggccgttcgcggcccgccgcccgcgcaccgggccagccgaattgctctatgtggggcgg
ctggagtacgagaagggcgtgcacgacgccatcgccgcgctgccgcggctcaggcgcact
cacccaggcaccacactgaccatcgccggcgaaggcacccagcaggattggttgatcgat
caggcccgcaaacaccgggtgctcagagcaaccaggttcgtcggacacctcgaccacacc
gagctgctggcgttgctgcaccgagccgacgccgcggtgctgcccagccactacgaaccg
tttgggctggtggcactggaggccgccgcggccggcaccccgctggtgacgtccaacatc
ggcggtctgggtgaagcggtcatcaatggacagaccggggtgtcgtgtgcaccccgcgac
gtagcggggctggccgccgcggtgcgtagcgtgctcgacgatccggccgccgcgcagcgg
cgcgcacgagccgcccggcaacggctcacctccgacttcgactggcagacggtggccacc
gcgaccgcgcaggtgtacctggcggcgaagcgcggtgaacggcagccgcagccccggttg
cccatcgtcgagcacgctcttcccgatcggtag

DBGET integrated database retrieval system