KEGG   Mycobacterium tuberculosis BT2: HKBT2_3531Help
Entry
HKBT2_3531        CDS       T03153                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
mtuu  Mycobacterium tuberculosis BT2
Pathway
mtuu00020  Citrate cycle (TCA cycle)
mtuu00480  Glutathione metabolism
mtuu01100  Metabolic pathways
mtuu01110  Biosynthesis of secondary metabolites
mtuu01120  Microbial metabolism in diverse environments
mtuu01130  Biosynthesis of antibiotics
mtuu01200  Carbon metabolism
mtuu01210  2-Oxocarboxylic acid metabolism
mtuu01230  Biosynthesis of amino acids
Module
mtuu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mtuu_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:mtuu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HKBT2_3531
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    HKBT2_3531
Enzymes [BR:mtuu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     HKBT2_3531
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AHJ48328
Structure
PDB: 

Position
complement(3710301..3711530)
Genome map
AA seq 409 aa AA seqDB search
MSNAPKIKVSGPVVELDGDEMTRVIWKLIKDMLILPYLDIRLDYYDLGIEHRDATDDQVT
IDAAYAIKKHGVGVKCATITPDEARVEEFNLKKMWLSPNGTIRNILGGTIFREPIVISNV
PRLVPGWTKPIVIGRHAFGDQYRATNFKVDQPGTVTLTFTPADGSAPIVHEMVSIPEDGG
VVLGMYNFKESIRDFARASFSYGLNAKWPVYLSTKNTILKAYDGMFKDEFERVYEEEFKA
QFEAAGLTYEHRLIDDMVAACLKWEGGYVWACKNYDGDVQSDTVAQGYGSLGLMTSVLMT
ADGKTVEAEAAHGTVTRHYRQYQAGKPTSTNPIASIFAWTRGLQHRGKLDGTPEVIDFAH
KLESVVIATVESGKMTKDLAILIGPEQDWLNSEEFLDAIADNLEKELAN
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacgcacccaagataaaagtcagcggtccggtcgtagagctcgacggtgacgag
atgacccgtgtcatctggaagctcatcaaggacatgcttatccttccctatctcgacatc
cgcttggactattacgacttgggcatcgagcaccgcgacgccaccgacgaccaggtgacg
atcgacgcggcgtatgcgatcaagaaacacggtgtgggcgtaaagtgcgcgacgatcacc
cccgacgaggcccgtgtcgaggaattcaacctgaagaagatgtggctgtcgcccaatggg
acaatccggaacatcttgggcggcacaatctttcgcgaacctatcgtgatttctaatgtg
ccgcgactggttccggggtggaccaagccgatcgtcatcggccggcacgcttttggtgac
caatatcgggcgacgaacttcaaggtcgaccaaccgggcaccgtcacactgactttcacg
cccgccgacggcagcgcgccgatcgtgcacgaaatggtgtccatccccgaggacggcggc
gtcgtgctggggatgtacaacttcaaggaatccatccgggatttcgcgcgcgcgtcgttc
tcctacggcctcaacgcgaaatggccggtatatctgtccaccaagaacaccatcctcaag
gcctacgacgggatgttcaaagacgagttcgagcgcgtctacgaagaggaattcaaggcg
cagttcgaagcggcggggctgacctacgagcatcggttgatcgacgacatggtcgccgcc
tgcctgaaatgggaaggcggttacgtctgggcgtgcaagaactacgacggcgacgtgcag
tcggacaccgtcgcacagggctacggctcgctgggcctgatgacgtcggtgctgatgacg
gccgacggcaagacagtcgaggccgaagccgcccacggcaccgtcacccggcattaccgg
cagtatcaggccggtaaaccgacctcaacaaacccgatcgcgtcgatctttgcctggacc
cgcggattacagcatcgcggcaagctggatggcactcccgaagtcatcgacttcgcccac
aagctggagtccgtcgtcatcgccacggtggagagcgggaagatgaccaaggacctcgcg
atcctcatcggtccggagcaggactggctgaatagcgaggaattcctcgatgcgatcgcc
gacaacctggaaaaggagctggccaattag

DBGET integrated database retrieval system