KEGG   Mycobacterium tuberculosis BT2: HKBT2_3756Help
Entry
HKBT2_3756        CDS       T03153                                 

Gene name
fadA5
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mtuu  Mycobacterium tuberculosis BT2
Pathway
mtuu00071  Fatty acid degradation
mtuu00072  Synthesis and degradation of ketone bodies
mtuu00280  Valine, leucine and isoleucine degradation
mtuu00310  Lysine degradation
mtuu00362  Benzoate degradation
mtuu00380  Tryptophan metabolism
mtuu00620  Pyruvate metabolism
mtuu00630  Glyoxylate and dicarboxylate metabolism
mtuu00640  Propanoate metabolism
mtuu00650  Butanoate metabolism
mtuu00900  Terpenoid backbone biosynthesis
mtuu01100  Metabolic pathways
mtuu01110  Biosynthesis of secondary metabolites
mtuu01120  Microbial metabolism in diverse environments
mtuu01130  Biosynthesis of antibiotics
mtuu01200  Carbon metabolism
mtuu01212  Fatty acid metabolism
mtuu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mtuu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    HKBT2_3756 (fadA5)
   00630 Glyoxylate and dicarboxylate metabolism
    HKBT2_3756 (fadA5)
   00640 Propanoate metabolism
    HKBT2_3756 (fadA5)
   00650 Butanoate metabolism
    HKBT2_3756 (fadA5)
  Lipid metabolism
   00071 Fatty acid degradation
    HKBT2_3756 (fadA5)
   00072 Synthesis and degradation of ketone bodies
    HKBT2_3756 (fadA5)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HKBT2_3756 (fadA5)
   00310 Lysine degradation
    HKBT2_3756 (fadA5)
   00380 Tryptophan metabolism
    HKBT2_3756 (fadA5)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HKBT2_3756 (fadA5)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HKBT2_3756 (fadA5)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    HKBT2_3756 (fadA5)
Enzymes [BR:mtuu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HKBT2_3756 (fadA5)
Exosome [BR:mtuu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HKBT2_3756 (fadA5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AHJ48553
Structure
PDB: 

Position
3975489..3976664
Genome map
AA seq 391 aa AA seqDB search
MGYPVIVEATRSPIGKRNGWLSGLHATELLGAVQKAVVDKAGIQSGLHAGDVEQVIGGCV
TQFGEQSNNISRVAWLTAGLPEHVGATTVDCQCGSGQQANHLIAGLIAAGAIDVGIACGI
EAMSRVGLGANAGPDRSLIRAQSWDIDLPNQFEAAERIAKRRGITREDVDVFGLESQRRA
QRAWAEGRFDREISPIQAPVLDEQNQPTGERRLVFRDQGLRETTMAGLGELKPVLEGGIH
TAGTSSQISDGAAAVLWMDEAVARAHGLTPRARIVAQALVGAEPYYHLDGPVQSTAKVLE
KAGMKIGDIDIVEINEAFASVVLSWARVHEPDMDRVNVNGGAIALGHPVGCTGSRLITTA
LHELERTDQSLALITMCAGGALSTGTIIERI
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgggttacccggtcatcgttgaagccacccgcagccccatcggcaaacgcaacggatgg
ctgtcggggctgcatgccaccgagttgttgggcgcggtgcaaaaggcggtggtcgacaag
gccggcatccagtccggccttcacgccggtgacgtcgaacaggtcatcggcggttgcgtg
acccagttcggggagcaatccaacaacatcagccgggtggcctggctgacggccggtttg
cccgaacacgtcggcgccaccaccgtcgactgccagtgcggcagcggccagcaggccaac
catctgattgccgggttgatcgcggccggtgccatcgatgtcggcatcgcctgcggcatc
gaggcgatgagccgggtcgggctgggcgccaacgccgggccggaccgctcgctgatccgc
gcgcagtcatgggatatcgacctgccgaaccagttcgaggccgccgagcggatcgccaag
cggcgcggcatcacccgcgaggacgtggatgtcttcgggctcgagtcgcagcgacgcgcg
cagcgggcctgggcggagggccgctttgaccgcgagatctcgccgatccaggcgccggtg
ctcgacgagcagaatcagcccaccggcgagcggcgcctggtctttcgcgaccagggcctg
cgcgagaccacgatggcggggctaggcgagctgaaaccggtgctcgagggcggcatccac
accgcgggcacgtcgtcgcagatctccgacggcgcggcagccgtgttgtggatggacgaa
gccgtggcacgtgcgcacggcctgaccccgcgggcccggatcgtcgcccaggcactcgtc
ggcgccgagccctactaccacctggacggcccggtgcagtccaccgcgaaggtgctggag
aaggccggcatgaagatcggcgacatcgacatcgtcgagatcaacgaggcgttcgcgtcc
gtggtgctgtcctgggcgcgggtgcacgagcccgacatggaccgggtcaacgtcaacggc
ggggcgatcgcgctggggcatccggtgggctgcaccggcagccggctgatcaccaccgcc
ctgcacgagctcgagcgcaccgaccagagcctcgcgctgatcaccatgtgcgccggcggg
gccctgtccaccggcaccatcatcgagcggatttaa

DBGET integrated database retrieval system