KEGG   Mycobacterium tuberculosis H37Rv: RVBD_0243Help
Entry
RVBD_0243         CDS       T02178                                 

Definition
(GenBank) acetyl-CoA acyltransferase FadA2
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mtv  Mycobacterium tuberculosis H37Rv
Pathway
mtv00071  Fatty acid degradation
mtv00072  Synthesis and degradation of ketone bodies
mtv00280  Valine, leucine and isoleucine degradation
mtv00310  Lysine degradation
mtv00362  Benzoate degradation
mtv00380  Tryptophan metabolism
mtv00620  Pyruvate metabolism
mtv00630  Glyoxylate and dicarboxylate metabolism
mtv00640  Propanoate metabolism
mtv00650  Butanoate metabolism
mtv00900  Terpenoid backbone biosynthesis
mtv01100  Metabolic pathways
mtv01110  Biosynthesis of secondary metabolites
mtv01120  Microbial metabolism in diverse environments
mtv01130  Biosynthesis of antibiotics
mtv01200  Carbon metabolism
mtv01212  Fatty acid metabolism
mtv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mtv00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RVBD_0243
   00630 Glyoxylate and dicarboxylate metabolism
    RVBD_0243
   00640 Propanoate metabolism
    RVBD_0243
   00650 Butanoate metabolism
    RVBD_0243
  Lipid metabolism
   00071 Fatty acid degradation
    RVBD_0243
   00072 Synthesis and degradation of ketone bodies
    RVBD_0243
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RVBD_0243
   00310 Lysine degradation
    RVBD_0243
   00380 Tryptophan metabolism
    RVBD_0243
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RVBD_0243
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RVBD_0243
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RVBD_0243
Enzymes [BR:mtv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RVBD_0243
Exosome [BR:mtv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RVBD_0243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AFN48096
UniProt: O86361 L0T5W9
Position
292171..293493
Genome map
AA seq 440 aa AA seqDB search
MAPAAKNTSQTRRRVAVLGGNRIPFARSDGAYADASNQDMFTAALSGLVDRFGLAGERLD
MVVGGAVLKHSRDFNLMRECVLGSELSPYTPAFDLQQACGTGLQAAIAAADGIAAGRYEV
AAAGGVDTTSDPPIGLGDDLRRTLLKLRRSRSNVQRLKLVGTLPASLGVEIPANSEPRTG
LSMGEHAAVTAKQMGIKRVDQDELAAASHRNMADAYDRGFFDDLVSPFLGLYRDDNLRPN
SSVEKLATLRPVFGVKAGDATMTAGNSTPLTDGASVALLASEQWAEAHSLAPLAYLVDAE
TAAVDYVNGNDGLLMAPTYAVPRLLARNGLSLQDFDFYEIHEAFASVVLAHLAAWESEEY
CKRRLGLDAALGSIDRSKLNVNGSSLAAGHPFAATGGRILAQTAKQLAEKKAAKKGGGPL
RGLISICAAGGQGVAAILEA
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtggcccctgctgctaagaacacttcacagaccaggcggcgagtcgccgtactgggcggc
aaccgcatcccgttcgccagatcggacggtgcctacgcggatgcgtccaaccaggacatg
ttcaccgcggcgctgagcggcttggtggaccgattcggactcgccggcgagcggctggac
atggtggtgggcggtgcggtgctcaaacacagccgcgacttcaatctaatgcgcgaatgc
gtgctgggctccgaactctcgccgtacacgccggcgttcgacctgcagcaggcctgcggg
acgggcctgcaggccgcgatcgcggccgccgacggcattgccgccgggcggtatgaggtg
gccgccgctggcggggtggacaccacctcggacccgccgatcggcctgggcgacgacctg
cgccgcaccctgctcaagctgcgccgatctaggtccaacgtgcaacgcctcaagctggtg
ggcacgctgccggccagcctgggcgtggagatccccgccaacagcgagccgcgcaccggg
ctgtcgatgggcgagcacgccgccgtcaccgccaagcagatgggcatcaaacgcgtagac
caggacgagctggccgccgccagccatcgcaatatggccgacgcctacgaccggggtttc
ttcgacgacctggtcagtccgtttttagggctgtaccgagacgacaatctgcggcctaac
tccagcgtcgagaaactggccacgctgcgtccggtcttcggagtgaaggccggtgacgcg
acgatgacggccggcaattcgactccgctgaccgacggcgcctcggtggcattgctggcc
agcgaacagtgggcggaggcacactcgctggctccgctggcctatctcgtggatgccgag
accgccgcggtcgactatgtcaacggcaacgacggcctgttgatggcgccgacctacgcg
gtaccccggctgctggcccgtaacgggttgagcctgcaggacttcgacttctacgaaatc
cacgaggcgtttgcctccgtggtgctcgcgcatctggcggcgtgggagtccgaggagtac
tgcaagcggcggctgggcctggacgccgcgctggggtcgatcgatcggtccaagctcaac
gtcaacgggtcgtcgttggccgccgggcaccccttcgcggcgaccggtgggcggattttg
gcgcagaccgccaagcagctcgccgagaagaaggcggcgaaaaaaggcggcggaccgctg
cgcgggctgatttcgatctgcgcggccggcggccaaggtgtggccgcgattttggaggcc
tga

DBGET integrated database retrieval system