KEGG   Mycobacterium tuberculosis H37Rv: RVBD_1011Help
Entry
RVBD_1011         CDS       T02178                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase IspE
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
mtv  Mycobacterium tuberculosis H37Rv
Pathway
mtv00900  Terpenoid backbone biosynthesis
mtv01100  Metabolic pathways
mtv01110  Biosynthesis of secondary metabolites
mtv01130  Biosynthesis of antibiotics
Module
mtv_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:mtv00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RVBD_1011
Enzymes [BR:mtv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     RVBD_1011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: AFN48901
UniProt: I6X018
Structure
PDB: 

Position
1130195..1131115
Genome map
AA seq 306 aa AA seqDB search
MPTGSVTVRVPGKVNLYLAVGDRREDGYHELTTVFHAVSLVDEVTVRNADVLSLELVGEG
ADQLPTDERNLAWQAAELMAEHVGRAPDVSIMIDKSIPVAGGMAGGSADAAAVLVAMNSL
WELNVPRRDLRMLAARLGSDVPFALHGGTALGTGRGEELATVLSRNTFHWVLAFADSGLL
TSAVYNELDRLREVGDPPRLGEPGPVLAALAAGDPDQLAPLLGNEMQAAAVSLDPALARA
LRAGVEAGALAGIVSGSGPTCAFLCTSASSAIDVGAQLSGAGVCRTVRVATGPVPGARVV
SAPTEV
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
gtgcccaccgggtcggtcaccgttcgggtgcccggaaaggtcaacctctatctggcggtc
ggcgatcgccgcgaggacggctatcacgagctgaccacggtatttcatgccgtctcgctg
gtcgacgaggtaaccgttcgtaacgctgatgtgctctcgctcgagttggtcggcgagggg
gccgaccagctgccgaccgacgaacgcaatctcgcctggcaggcggccgagctgatggcc
gaacacgtgggccgggcgccggacgtctcgatcatgatcgacaaatccattccggtcgcc
ggcggcatggccggtggcagcgcggacgctgcggcggtcctggttgcgatgaactcgttg
tgggaactcaatgtgccccgccgcgacctgcgcatgctcgccgcgcggctaggcagcgat
gtgccgtttgccctgcatggtggtaccgcgctggggacgggtcgcggcgaggagttggcc
accgtgttatcccgcaacaccttccactgggtcctggcgttcgccgacagcgggttgctc
acctccgcggtgtacaacgagctcgaccggctcagggaggtgggggatccgccccggctt
ggtgagcccgggccggttctggctgccttagctgcgggtgatccggatcagctggcgccg
ttgctgggtaatgaaatgcaagcggccgcggtgagcctggacccggcgctggctcgtgcg
ttacgcgccggtgtggaggccggcgcgctcgcaggcatcgtgtccggttcgggtcccacg
tgtgccttcctgtgcacctcggcgagctcggcgatcgatgtcggcgcgcagctgtcgggg
gcgggagtttgtcgcaccgttcgagtcgccaccgggccggtacccggcgcccgcgtggtg
tctgcgccgaccgaagtgtga

DBGET integrated database retrieval system