KEGG   Mycobacterium tuberculosis H37Rv: RVBD_1826
Entry
RVBD_1826         CDS       T02178                                 

Definition
(GenBank) glycine cleavage system H protein GcvH
  KO
K02437  glycine cleavage system H protein
Organism
mtv  Mycobacterium tuberculosis H37Rv
Pathway
mtv00260  Glycine, serine and threonine metabolism
mtv00630  Glyoxylate and dicarboxylate metabolism
mtv01100  Metabolic pathways
mtv01110  Biosynthesis of secondary metabolites
mtv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mtv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RVBD_1826
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RVBD_1826
SSDB
Motif
Pfam: GCV_H Biotin_lipoyl RnfC_N
Other DBs
NCBI-ProteinID: AFN49755
Structure
PDB: 
3HGB 3IFT

Position
2071959..2072363
AA seq 134 aa
MSDIPSDLHYTAEHEWIRRSGDDTVRVGITDYAQSALGDVVFVQLPVIGTAVTAGETFGE
VESTKSVSDLYAPISGKVSEVNSDLDGTPQLVNSDPYGAGWLLDIQVDSSDVAALESALT
TLLDAEAYRGTLTE
NT seq 405 nt   +upstreamnt  +downstreamnt
gtgagcgatatcccgtccgatctgcactacaccgccgaacacgagtggattcgccgcagt
ggcgacgacaccgtccgggtggggatcaccgactatgcacagtcggcgcttggcgacgtc
gttttcgttcagctacccgttatcggcaccgcggtcaccgccggcgagaccttcggcgaa
gtggaatcgacgaaatctgtgtcggatctctatgcgcccatttcgggtaaggtgtctgag
gtcaacagcgatctggacggcactccgcaattggtgaattccgacccctacggagccggc
tggctgctggacatccaggtcgacagctcggatgtcgctgccctggagtcagctttgacg
acactgctcgacgctgaggcctaccgcggcacactgaccgagtga

DBGET integrated database retrieval system