KEGG   Mycobacterium tuberculosis H37Rv: RVBD_1862Help
Entry
RVBD_1862         CDS       T02178                                 

Definition
(GenBank) alcohol dehydrogenase AdhA
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mtv  Mycobacterium tuberculosis H37Rv
Pathway
mtv00010  Glycolysis / Gluconeogenesis
mtv00071  Fatty acid degradation
mtv00350  Tyrosine metabolism
mtv00625  Chloroalkane and chloroalkene degradation
mtv00626  Naphthalene degradation
mtv01100  Metabolic pathways
mtv01110  Biosynthesis of secondary metabolites
mtv01120  Microbial metabolism in diverse environments
mtv01130  Biosynthesis of antibiotics
mtv01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mtv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RVBD_1862
  Lipid metabolism
   00071 Fatty acid degradation
    RVBD_1862
  Amino acid metabolism
   00350 Tyrosine metabolism
    RVBD_1862
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RVBD_1862
   00626 Naphthalene degradation
    RVBD_1862
Enzymes [BR:mtv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RVBD_1862
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AFN49791
UniProt: I6X2I0
Position
2109551..2110591
Genome map
AA seq 346 aa AA seqDB search
MVSPATTATMSAWQVRRPGPMDTGPLERVTTRVPRPAPSELLVAVHACGVCRTDLHVTEG
DLPVHRERVIPGHEVVGEVIEVGSAVGAAAGGEFDRGDRVGIAWLRHTCGVCKYCRRGSE
NLCPQSRYTGWDADGGYAEFTTVPAAFAHHLPSGYSDSELAPLLCAGIIGYRSLLRTELP
PGGRLGLYGFGGSAHITAQVALAQGAEIHVMTRGARARKLALQLGAASAQDAADRPPVPL
DAAILFAPVGDLVLPALEALDRGGILAIAGIHLTDIPDLNYQQHLFQERQIRSVTSNTRA
DARAFFDFAAQHHIEVTTPEYPLGQADRALGDLSAGRIAGAAVLLI
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggtctcaccggcgaccacggcgacgatgagtgcgtggcaggtgcgtcggcccggcccg
atggacaccggcccgctcgaacgagtgaccacccgggtgccgcgcccggcgccatcggag
ttgctggtggccgtgcacgcatgcggggtgtgccgcaccgatctccacgtgaccgaaggt
gacctgcccgtgcaccgcgaacgggtgattcccggccacgaggtagtgggagaggtcatt
gaggtgggctcagcggtgggcgcggctgccggtggcgaattcgaccgaggagaccgggtg
ggtatcgcctggctgcgtcacacttgcggggtctgcaagtactgccggcgcggcagcgag
aacctctgcccgcaatcccgctacaccggctgggacgccgacgggggatacgccgaattc
acgacggttcctgcggctttcgcgcaccatctgccgagcggctatagcgacagcgagctg
gcgccgttgttgtgcgccggcatcatcggatatcgatcgctgctgcgcaccgagctacca
cccggtggccggctgggtctctacggattcggcggcagtgcccacatcaccgcccaggtc
gcgttggcgcaaggcgccgaaatacatgtgatgacacgcggggcccgcgcgcgcaagctg
gcgctgcaacttggcgctgcatcggctcaggacgccgccgaccggccacccgtgccgctg
gacgccgcgatcttattcgccccggtcggggatctggtgctgcccgcgctggaagcgctg
gaccgtggcggcatcttggcgatcgccgggatccacctgacagatattccggacctgaac
taccagcagcacttgttccaggagcgtcagatccggtcggtcacgtcgaacacccgcgcc
gatgcgcgcgcgttcttcgacttcgccgcccagcatcacatcgaggtcaccacgccggag
tacccgcttggccaagccgatcgtgcgctgggcgacctgagcgccggccgcatcgccggt
gccgccgtgctgctgatctga

DBGET integrated database retrieval system