KEGG   Mycobacterium tuberculosis H37Rv: RVBD_2203
Entry
RVBD_2203         CDS       T02178                                 

Definition
(GenBank) membrane protein
Organism
mtv  Mycobacterium tuberculosis H37Rv
SSDB
Motif
Pfam: PUFD
Other DBs
NCBI-ProteinID: AFN50152
Position
2468239..2468931
AA seq 230 aa
MPGPHSPNPGVGTNGPAPYPEPSSHEPQALDYPHDLGAAEPAFAPGPADDAALPPAAYPG
VPPQVSYPKRRHKRLLIGIVVALALVSAMTAAIIYGVRTNGANTAGTFSEGPAKTAIQGY
LNALENRDVDTIVRNALCGIHDGVRDKRSDQALAKLSSDAFRKQFSQVEVTSIDKIVYWS
QYQAQVLFTMQVTPAAGGPPRGQVQGIAQLLFQRGQVLVCSYVLRTAGSY
NT seq 693 nt   +upstreamnt  +downstreamnt
atgcccggtccccactcgccgaaccccggtgtcggcaccaacggaccggcgccgtacccc
gagccctcatcccacgaaccccaagccctggactacccccacgacctcggcgccgccgaa
ccggccttcgccccgggaccggcagacgacgcggcgctgccgcccgccgcatatcccggc
gtgccgccgcaggtgtcctacccgaagcgacggcacaagcggctgctgatcggcattgtg
gtagccctcgcgctggtgtcggctatgacggcggcgatcatatacggggtccgcaccaac
ggagccaacacggcaggcacattctcggagggaccggccaaaaccgcgattcagggatac
ctcaacgcgctggagaaccgcgatgtggacaccatcgttcgcaatgcgctgtgcggtatc
cacgacggcgtgcgcgacaagcgctccgatcaggccttggccaagctgagcagcgacgcg
ttccgcaagcagttctcccaggtcgaagtgacctcgatcgacaaaatcgtgtactggtcg
caatatcaggcccaggtgctgttcaccatgcaggtgacacctgccgccggcggcccgcca
cgcggtcaggtgcaaggcatcgctcagttgcttttccagcgcggtcaggtcttggtgtgc
tcgtacgtgttgcgcaccgcggggtcgtactag

DBGET integrated database retrieval system