KEGG   Mycobacterium tuberculosis H37Rv: RVBD_2495cHelp
Entry
RVBD_2495c        CDS       T02178                                 

Definition
(GenBank) branched-chain keto acid dehydrogenase E2 component BkdC
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mtv  Mycobacterium tuberculosis H37Rv
Pathway
mtv00010  Glycolysis / Gluconeogenesis
mtv00020  Citrate cycle (TCA cycle)
mtv00620  Pyruvate metabolism
mtv01100  Metabolic pathways
mtv01110  Biosynthesis of secondary metabolites
mtv01120  Microbial metabolism in diverse environments
mtv01130  Biosynthesis of antibiotics
mtv01200  Carbon metabolism
Module
mtv_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mtv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RVBD_2495c
   00020 Citrate cycle (TCA cycle)
    RVBD_2495c
   00620 Pyruvate metabolism
    RVBD_2495c
Enzymes [BR:mtv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     RVBD_2495c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2 Ribosomal_L13
Motif
Other DBs
NCBI-ProteinID: AFN50463
UniProt: I6Y0V8
Structure
PDB: 

Position
complement(2808768..2809949)
Genome map
AA seq 393 aa AA seqDB search
MSGEDSIRSFPVPDLGEGLQEVTVTCWSVAVGDDVEINQTLCSVETAKAEVEIPSPYAGR
IVELGGAEGDVLKVGAELVRIDTGPTAVAQPNGEGAVPTLVGYGADAAIETSRRTSRPLA
APVVRKLAKELAVDLAALQRGSGAGGVITRADVLAAARGGVGAGPDVRPVHGVHARMAEK
MTLSHKEIPTAKASVEVICAELLRLRDRFVSAAPEITPFALTLRLLVIALKHNVILNSTW
VDSGEGPQVHVHRGVHLGFGAATERGLLVPVVTDAQDKNTRELASRVAELITGAREGTLT
PAELRGSTFTVSNFGALGVDDGVPVINHPEAAILGLGAIKPRPVVVGGEVVARPTMTLTC
VFDHRVVDGAQVAQFMCELRDLIESPETALLDL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagcggtgaggacagcatcaggtctttcccggtgcccgacctcggcgagggactgcag
gaagtgacggtgacgtgttggagcgtcgccgtcggcgacgatgtggagatcaaccagacg
ctgtgttcggtggagaccgccaaggccgaggtcgaaatccccagcccgtatgccggccgg
atcgtcgagttaggcggcgccgaaggcgatgtgctcaaagtgggcgcggagctagttcgg
atcgacaccgggcccacggcagttgcgcagcctaacggtgaaggagcggtccccacgttg
gtcggctacggtgccgacgccgcgatcgaaaccagtagacggacaagccggccgctggcg
gcaccggtagtgcgcaagctggccaaagagttggcggtcgacctggccgcattgcagcgt
gggtcgggcgccggcggtgtgatcacccgggccgatgtgctggccgctgctcgaggcggc
gtcggagccgggccggacgtgcggccggtccacggcgtgcacgcgcggatggccgaaaaa
atgacgttgtcccacaaggagattccgaccgcaaaggccagcgttgaggtaatttgcgcc
gaactgctgcggctgcgcgaccggttcgtttcggcggcgcccgagattacaccgttcgcg
ctgacgctgcggctgctggttattgcattgaaacacaacgtaattctcaactcgacgtgg
gtcgactcgggcgaaggcccgcaagtacacgtgcatcgcggtgtgcatctggggttcggc
gcggccactgagcgtggattgctggtgccggtggtgaccgacgcccaggacaagaacacc
cgcgaacttgcctcccgcgtagcggaattaatcaccggcgcacgtgaaggcactctcaca
cccgcggagctgcgcggttcgacgttcacggtgtcgaacttcggggcgctgggagtcgac
gacggcgtgccggtgatcaaccatcccgaagcggcgatcctgggtctgggggcgatcaag
ccgcgcccggtggtcgtcggcggcgaggttgtcgcacggccgacgatgacgttgacttgt
gtgttcgaccaccgcgttgtcgatggtgctcaggtggcccagttcatgtgtgagctgcgg
gatctgatcgagtcgccggagaccgcgctgttggatctgtag

DBGET integrated database retrieval system