KEGG   Mycobacterium tuberculosis H37Rv: RVBD_2882c
Entry
RVBD_2882c        CDS       T02178                                 

Definition
(GenBank) ribosome recycling factor Frr
  KO
K02838  ribosome recycling factor
Organism
mtv  Mycobacterium tuberculosis H37Rv
Brite
KEGG Orthology (KO) [BR:mtv00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:mtv03012]
    RVBD_2882c
Translation factors [BR:mtv03012]
 Eukaryotic type
  Release factors
   RVBD_2882c
 Prokaryotic type
   RVBD_2882c
SSDB
Motif
Pfam: RRF Phage_TAC_4
Other DBs
NCBI-ProteinID: AFN50863
Structure
PDB: 

Position
complement(3191654..3192211)
AA seq 185 aa
MIDEALFDAEEKMEKAVAVARDDLSTIRTGRANPGMFSRITIDYYGAATPITQLASINVP
EARLVVIKPYEANQLRAIETAIRNSDLGVNPTNDGALIRVAVPQLTEERRRELVKQAKHK
GEEAKVSVRNIRRKAMEELHRIRKEGEAGEDEVGRAEKDLDKTTHQYVTQIDELVKHKEG
ELLEV
NT seq 558 nt   +upstreamnt  +downstreamnt
atgattgatgaggctctcttcgacgccgaagagaaaatggagaaggctgtggcggtggca
cgtgacgacctgtcaactatccgtaccggccgcgccaaccctggcatgttctctcggatc
accatcgactactacggtgcggccaccccgatcacgcaactggccagcatcaatgtcccc
gaggcgcggctagtcgtgataaagccgtatgaagccaatcagttgcgcgctatcgagact
gcaattcgcaactccgaccttggagtgaatcccaccaacgacggcgcccttattcgcgtg
gccgtaccgcagctcaccgaagaacgtcggcgagagctggtcaaacaggcaaagcataag
ggggaggaggccaaggtttcggtgcgtaatatccgtcgcaaagcgatggaggaactccat
cgcatccgtaaggaaggcgaggccggcgaggatgaggtcggtcgcgcagaaaaggatctc
gacaagaccacgcaccaatacgtcacccaaattgatgagctggttaaacacaaagaaggc
gagctgctggaggtctag

DBGET integrated database retrieval system