KEGG   Mycobacterium tuberculosis H37Rv: RVBD_3273
Entry
RVBD_3273         CDS       T02178                                 

Definition
(GenBank) transmembrane carbonic anhydrase
  KO
K01673  carbonic anhydrase [EC:4.2.1.1]
Organism
mtv  Mycobacterium tuberculosis H37Rv
Pathway
mtv00910  Nitrogen metabolism
mtv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtv00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    RVBD_3273
Enzymes [BR:mtv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     RVBD_3273
SSDB
Motif
Pfam: Sulfate_transp Pro_CA
Other DBs
NCBI-ProteinID: AFN51279
UniProt: P96878
Position
3654634..3656928
AA seq 764 aa
MTIPRSQHMSTAVNSCTEAPASRSQWMLANLRHDVPASLVVFLVALPLSLGIAIASGAPI
IAGVIAAVVGGIVAGAVGGSPVQVSGPAAGLTVVVAELIDELGWPMLCLMTIAAGALQIV
FGLSRMARAALAIAPVVVHAMLAGIGITIALQQIHVLLGGTSHSSAWRNIVALPDGILHH
ELHEVIVGGTVIAILLMWSKLPAKVRIIPGPLVAIAGATVLALLPVLQTERIDLQGNFFD
AIGLPKLAEMSPGGQPWSHEISAIALGVLTIALIASVESLLSAVGVDKLHHGPRTDFNRE
MVGQGSANVVSGLLGGLPITGVIVRSSANVAAGARTRMSTILHGVWILLFASLFTNLVEL
IPKAALAGLLIVIGAQLVKLAHIKLAWRTGNFVIYAITIVCVVFLNLLEGVAIGLVVAIV
FLLVRVVRAPVEVKPVGGEQSKRWRVDIDGTLSFLLLPRLTTVLSKLPEGSEVTLNLNAD
YIDDSVSEAISDWRRAHETRGGVVAIVETSPAKLHHAHARPPKRHFASDPIGLVPWRSAR
GKDRGSASVLDRIDEYHRNGAAVLHPHIAGLTDSQDPYELFLTCADSRILPNVITASGPG
DLYTVRNLGNLVPTDPDDRSVDAALDFAVNQLGVSSVVVCGHSSCAAMTALLEDDPANTT
TPMMRWLENAHDSLVVFRNHHPARRSAESAGYPEADQLSIVNVAVQVERLTRHPILATAV
AAADLQVIGIFFDISTARVYEVGPNGIICPDEPADRPVDHESAQ
NT seq 2295 nt   +upstreamnt  +downstreamnt
gtgaccattccgaggagtcaacacatgagcaccgcagtcaacagctgcaccgaggcgccc
gcatcgcgatcacagtggatgctggctaatctgcggcacgatgttcccgcatcacttgtc
gtcttccttgttgcgttgccactttcgctggggatcgcgatcgcctccggggccccgata
atcgccggtgtgatcgccgccgtcgtaggcggcattgtcgccggggcggtcggtgggtcg
ccggttcaggtcagcggcccggccgcgggtctgaccgtggtggtcgccgagctgatcgat
gagctcggttggccgatgctgtgtctgatgacgatcgccgcgggtgcactgcagatcgtg
ttcggcctaagtcggatggcgcgcgccgcgctggccatcgccccggtcgtggtgcacgcc
atgctggccggcatcggtatcaccatcgcgctgcagcaaattcatgttctgctcggtggt
acgtcgcacagctcggcgtggcggaacatcgtagcgttgccggacggcatcctccatcac
gaactgcacgaagtgatcgtcggcgggacggttatcgcgatcctgttgatgtggtcaaag
ctgcccgccaaggtgcgtatcattcccggcccactggtagccatcgcgggcgcgaccgtg
cttgcgttgctacccgtgctacaaaccgaacgaatcgacctgcagggcaacttcttcgac
gcgattggcttgcccaaacttgccgaaatgtccccgggaggacagccgtggtctcatgag
atcagcgccatcgcgctcggtgtcctcaccattgcgctgatcgcaagcgtcgaatcgctg
ctgtcggcggtcggtgtcgacaagctgcatcacggcccgcgcaccgacttcaaccgggag
atggtcgggcagggcagcgcgaacgtggtgtccggattgctcggcgggctgcccatcacc
ggtgtcatcgtgcgcagctcggccaacgtggccgccggcgcccgaacccggatgtcgacg
atcctgcacggagtgtggatcctgctgtttgcgtcactgttcaccaacctggtggaactg
attcccaaggcggcgctggccggcctgctcatcgtgatcggtgcccagctggtcaagctg
gcgcacatcaaactagcttggcgcacaggaaatttcgtaatctacgccatcaccatcgtg
tgtgtggtgttcctcaatctgctggaaggcgtggccatcgggctggtcgtggcgatcgta
ttcctgttggtgcgggtggtacgcgcgcccgtcgaggtcaagccggtcggcggcgagcag
tccaagcgatggcgggtcgatatcgacggcacgttgagcttcctgctgctgccccgcctg
accacggtgctctcgaagctgccggaagggtcggaggtgacgttaaacctgaacgcagac
tacatcgacgactccgtttccgaggccatctccgattggcggcgcgcccacgagacgagg
ggcggagtggtagcgatcgtggaaacgtcgccggccaaactgcaccacgcacacgcccga
ccaccgaagcgccacttcgcgtctgatccgattggactggttccgtggcgatcagcgcgc
ggcaaagaccgcggcagcgcttcggttctcgaccgcatcgacgagtatcaccgcaatggc
gcggccgtgctgcacccgcatatcgccgggctgaccgattcacaggacccgtatgagctg
ttcctcacctgtgccgactcgcggattctgccgaacgtcatcaccgccagcggccccggc
gacctgtacaccgtccgcaacctcggcaacctggtgccgaccgatccggacgaccgatcg
gttgacgcggcactcgacttcgccgtcaaccagctcggcgtcagctcggttgtcgtctgc
ggacattcgtcgtgtgctgcgatgacggcgctcctggaagacgacccggccaacacgacg
actcccatgatgcgttggctcgagaatgcccacgacagcctggtggtgttccgcaatcac
cacccggcacgccgcagcgccgaatccgccggttaccccgaagccgaccagctgagcatc
gtaaacgttgccgttcaggtggaaaggctgacccgccacccgatcttggcgaccgcggtc
gccgctgctgatctacaggtcatcggcatattcttcgacatctcgaccgcccgggtatac
gaggtgggtccgaacggcatcatctgcccggacgagccggccgaccgccccgtcgaccac
gaatcagcgcagtag

DBGET integrated database retrieval system