KEGG   Mycobacterium tuberculosis H37Rv: RVBD_3523Help
Entry
RVBD_3523         CDS       T02178                                 

Definition
(GenBank) lipid carrier protein or keto acyl-CoA thiolase Ltp3
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mtv  Mycobacterium tuberculosis H37Rv
Pathway
mtv00071  Fatty acid degradation
mtv00072  Synthesis and degradation of ketone bodies
mtv00280  Valine, leucine and isoleucine degradation
mtv00310  Lysine degradation
mtv00362  Benzoate degradation
mtv00380  Tryptophan metabolism
mtv00620  Pyruvate metabolism
mtv00630  Glyoxylate and dicarboxylate metabolism
mtv00640  Propanoate metabolism
mtv00650  Butanoate metabolism
mtv00900  Terpenoid backbone biosynthesis
mtv01100  Metabolic pathways
mtv01110  Biosynthesis of secondary metabolites
mtv01120  Microbial metabolism in diverse environments
mtv01130  Biosynthesis of antibiotics
mtv01200  Carbon metabolism
mtv01212  Fatty acid metabolism
mtv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mtv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RVBD_3523
   00630 Glyoxylate and dicarboxylate metabolism
    RVBD_3523
   00640 Propanoate metabolism
    RVBD_3523
   00650 Butanoate metabolism
    RVBD_3523
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RVBD_3523
   00072 Synthesis and degradation of ketone bodies
    RVBD_3523
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RVBD_3523
   00310 Lysine degradation
    RVBD_3523
   00380 Tryptophan metabolism
    RVBD_3523
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RVBD_3523
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RVBD_3523
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RVBD_3523
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mtv04147]
    RVBD_3523
Enzymes [BR:mtv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RVBD_3523
Exosome [BR:mtv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RVBD_3523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M22 Thiolase_N
Motif
Other DBs
NCBI-ProteinID: AFN51540
UniProt: L0TFX4 I6YGD8
Position
3959708..3960892
Genome map
AA seq 394 aa AA seqDB search
MAGKLAAVLGTGQTKYVAKRQDVSMNGLVREAIDRALADSGSTFDDIDAVVVGKAPDFFE
GVMMPELFMADAMGATGKPLIRVHTAGSVGGSTGVVAASLVQSGKYRRVLALAWEKQSES
NAMWALSIPVPFTKPVGAGAGGYFAPHVRAYIRRSGAPAHIGAMVAVKDRLNGSRNPLAH
LQQPDITLEKVMASQMLWDPIRFDETCPSSDGACAVVVGDEEIADARLAQGHPVAWIHGT
ALRTEPLAFAGRDQVNPQAGRDAAAALWKAAGITSPIDEIDAAEIYVPFSWFEPMWLENL
GFAREGEGWKLTEAGETAIGGRLPVNPSGGVLSANPIGASGLIRFAEAAIQVMGKAEARQ
VPGARKALGHAYGGGSQYFSMWVVGCEKPKQAAA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggccggaaagctggccgccgtactcggcaccgggcagaccaagtatgtcgccaagcgc
caagacgtttcgatgaacggtctggtgcgggaggccatcgaccgagcgctggcggattcc
ggttccaccttcgacgacatcgacgccgtcgtggtcggcaaggcgcccgacttcttcgaa
ggggtgatgatgccggagctattcatggccgacgccatgggcgcgaccggcaagccgctg
atccgggtacacaccgccggttcggttggcggatccaccggggtagtggctgccagcctg
gtgcaatccggcaaataccgccgggtcctggcattagcctgggaaaagcagtcggaatcc
aatgccatgtgggcgttgtcgattcctgtgccgttcaccaaaccggtcggtgccggtgcg
gggggatacttcgccccgcatgtccgggcctatatccgccgctcgggcgcaccggcacac
atcggtgctatggttgcggtcaaggaccggctcaacggcagccgcaacccgttggcacat
ctgcagcagcccgacatcaccctggagaaggtgatggcatctcagatgctctgggatcca
atacgtttcgatgagacgtgcccgtcgtcagacggtgcgtgcgcggttgtcgtcggcgac
gaggagatcgccgacgcgcgactggcgcaagggcatccggtggcctggattcatggcacc
gcattacgcaccgagccgctggctttcgccgggcgcgaccaggtcaacccgcaggccggc
cgcgacgcggcggcggcgctgtggaaggccgcgggcatcaccagccccatcgacgaaatc
gacgccgccgaaatttacgtcccgttctcctggttcgagccgatgtggttggagaatctg
ggatttgcccgcgagggcgagggctggaagctcaccgaggccggcgagactgcgatcggc
ggtcgactaccggtgaacccttccggcggcgtgctgtccgccaatccgatcggcgcatcg
ggcctgatccgcttcgccgaggccgcgatccaagtcatgggcaaggcggaggcgcgtcaa
gttccgggtgcgcgaaaggccttggggcacgcttacggtggcggctcgcagtacttctct
atgtgggtggtcggctgcgagaaacccaaacaggcagccgcataa

DBGET integrated database retrieval system