KEGG   Mycobacterium tuberculosis H37Rv: RVBD_3566cHelp
Entry
RVBD_3566c        CDS       T02178                                 

Definition
(GenBank) arylamine N-acetyltransferase Nat
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
mtv  Mycobacterium tuberculosis H37Rv
Pathway
mtv00983  Drug metabolism - other enzymes
mtv01100  Metabolic pathways
mtv01110  Biosynthesis of secondary metabolites
mtv01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mtv00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    RVBD_3566c
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    RVBD_3566c
   00983 Drug metabolism - other enzymes
    RVBD_3566c
Enzymes [BR:mtv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     RVBD_3566c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-ProteinID: AFN51584
UniProt: P9WJI5
Structure
PDB: 

Position
complement(4007510..4008361)
Genome map
AA seq 283 aa AA seqDB search
MALDLTAYFDRINYRGATDPTLDVLQDLVTVHSRTIPFENLDPLLGVPVDDLSPQALADK
LVLRRRGGYCFEHNGLMGYVLAELGYRVRRFAARVVWKLAPDAPLPPQTHTLLGVTFPGS
GGCYLVDVGFGGQTPTSPLRLETGAVQPTTHEPYRLEDRVDGFVLQAMVRDTWQTLYEFT
TQTRPQIDLKVASWYASTHPASKFVTGLTAAVITDDARWNLSGRDLAVHRAGGTEKIRLA
DAAAVVDTLSERFGINVADIGERGALETRIDELLARQPGADAP
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggcactggatctgaccgcgtacttcgatcgcatcaactatcgcggcgctaccgatcca
accctggatgttctgcaggatctggtgaccgtgcacagtcgaacgattccgttcgagaac
ctcgacccgctgctgggggtgccggtcgacgacctcagtccacaggcgctggccgacaag
ctggtacttcggcgccgaggcgggtactgctttgagcacaacgggctgatgggttatgtg
ctggccgaactcggctatcgggtgcgccgattcgccgcccgcgtcgtctggaagctcgcg
ccggacgcgcccctgccgccgcagacgcacaccctgctgggggtcacgttccccggctcg
ggcggatgctatctcgtcgacgtcggattcggcggccaaacaccgacctcaccgcttcgc
ctcgaaaccggcgccgtccagccgacaacgcacgaaccttatcggctcgaggaccgcgtc
gacggctttgtcttgcaggcgatggtccgggacacatggcagacactgtacgaattcacc
acccagacccgcccgcagatcgatctgaaagtggccagctggtacgcctcaacacacccg
gcatcgaagttcgtcacgggactgaccgccgcggtgatcaccgacgacgcccggtggaac
ctatctggccgcgaccttgccgttcaccgtgccggtggtaccgagaagatccgccttgcc
gatgcggcagcggttgtcgacaccctgagcgaacggttcgggatcaacgtggcagatatc
ggcgagcgcggcgcgctcgagacgcgcatcgacgagctattggctcggcagccaggagcc
gatgcgccgtaa

DBGET integrated database retrieval system