KEGG   Methylosinus trichosporium: CQW49_15765Help
Entry
CQW49_15765       CDS       T05155                                 

Definition
(GenBank) acetate/propionate family kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
mtw  Methylosinus trichosporium
Pathway
mtw00430  Taurine and hypotaurine metabolism
mtw00620  Pyruvate metabolism
mtw00640  Propanoate metabolism
mtw00680  Methane metabolism
mtw01100  Metabolic pathways
mtw01120  Microbial metabolism in diverse environments
mtw01200  Carbon metabolism
Module
mtw_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:mtw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CQW49_15765
   00640 Propanoate metabolism
    CQW49_15765
  09102 Energy metabolism
   00680 Methane metabolism
    CQW49_15765
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    CQW49_15765
Enzymes [BR:mtw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     CQW49_15765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: ATQ69175
UniProt: A0A2D2D2G4
Position
complement(3297628..3298818)
Genome map
AA seq 396 aa AA seqDB search
MTGVLLALNAGSSSLKFALYDASSLTPLCRGAAAALGAKGQAAHFSAQGSAAEPLAAGAA
LAPDIDHEGAARWLIERIGARLPELELAVVGHRVVHGGAEFSSPVRVTPEILARLEAYIP
LAPGHQPHNLAPIHSLLASRPDLPQIACFDTAFHRTQPRVAQLFPLPRAFAERGVLRYGF
HGLSYQFIAQELRRLLPERAQGRVIVAHLGHGASLCAMRGLESVATTMGFTALDGLMMGS
RSGAIDPGLLLHLILQEGLSALAVHKLLYDESGLLGVSGISDDLRALEADGSPVAEEAMA
LFAYRAAREIGSLASALGGLDCLVFTAGIGENSPTMRARICGYLGYLGVALDDAANARGA
LSIGAGAAEVLVVATNEEAVIAEAARGLWREGAAGR
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtgaccggcgtcctgctcgcgctgaacgccggctcgtccagcctcaaattcgcgctctat
gacgcgtcgtcgctcacgcctctctgtcgcggcgcggctgcggcgctcggcgccaagggg
caggcggcgcatttttccgcgcaggggtccgccgcggaaccgctcgcggccggagccgcg
ctcgcgccggacatcgatcatgaaggcgcggcgcgttggctgatcgagcgcatcggcgcg
cgcctgccggagctggagctcgccgtcgtcggccatagagtcgtgcatggcggagcggag
ttttcgtcccccgtgcgggtgacgccggagattctggcgcgtctcgaggcttatattccg
ctcgcgcccggccatcagccgcataatctcgcgccgatccacagcctgctggcgagccgg
cccgatttgccgcagatcgcctgtttcgacacggccttccaccggacgcagccgcgcgtc
gcgcaattgtttccgctgccgcgcgccttcgccgagcgcggcgtgctgcgctacggcttc
catgggctctcctatcaattcatcgcgcaggagctgcggcggctgctgcccgagcgagcg
caaggccgcgtgatcgtcgcgcatctcggccatggcgcgagcctctgcgcgatgcgcgga
ctcgagagcgtcgccacgacgatgggcttcaccgcgctcgacgggctgatgatgggctcg
cgcagcggcgcgatcgatcccgggctgctgctgcatctcattctgcaggagggcctgtcg
gcgctggccgtgcataagctgctctatgacgaatcgggcctcctcggcgtctccgggatc
agcgacgatctgcgcgcgctcgaggccgacggctcgcctgtcgccgaggaggcgatggcg
ctgttcgcctatcgcgccgcgcgcgagatcggctcgctggcgagcgcgctgggcggactc
gactgtctcgtgttcacggccggaatcggcgagaattcgccgacgatgcgcgcgcgcatc
tgcggctatctcggctatctcggcgtggcgctcgacgacgcggccaacgcccgcggcgcg
ctatcgatcggcgccggcgcggccgaggttctggtcgtcgccaccaatgaggaggcggtg
atcgccgaagccgcccgcgggctctggcgcgagggcgcggccgggcgctga

DBGET integrated database retrieval system