KEGG   Mycobacterium tuberculosis EAI5: M943_04500Help
Entry
M943_04500        CDS       T02749                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mtx  Mycobacterium tuberculosis EAI5
Pathway
mtx00071  Fatty acid degradation
mtx00072  Synthesis and degradation of ketone bodies
mtx00280  Valine, leucine and isoleucine degradation
mtx00310  Lysine degradation
mtx00362  Benzoate degradation
mtx00380  Tryptophan metabolism
mtx00620  Pyruvate metabolism
mtx00630  Glyoxylate and dicarboxylate metabolism
mtx00640  Propanoate metabolism
mtx00650  Butanoate metabolism
mtx00900  Terpenoid backbone biosynthesis
mtx01100  Metabolic pathways
mtx01110  Biosynthesis of secondary metabolites
mtx01120  Microbial metabolism in diverse environments
mtx01130  Biosynthesis of antibiotics
mtx01200  Carbon metabolism
mtx01212  Fatty acid metabolism
mtx02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mtx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    M943_04500
   00630 Glyoxylate and dicarboxylate metabolism
    M943_04500
   00640 Propanoate metabolism
    M943_04500
   00650 Butanoate metabolism
    M943_04500
  09103 Lipid metabolism
   00071 Fatty acid degradation
    M943_04500
   00072 Synthesis and degradation of ketone bodies
    M943_04500
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    M943_04500
   00310 Lysine degradation
    M943_04500
   00380 Tryptophan metabolism
    M943_04500
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    M943_04500
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    M943_04500
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    M943_04500
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mtx04147]
    M943_04500
Enzymes [BR:mtx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     M943_04500
Exosome [BR:mtx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   M943_04500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AGQ34358
Structure
PDB: 

Position
953701..954939
Genome map
AA seq 412 aa AA seqDB search
MEFVEQEIDMSEEAFIYEAIRTPRGKQKNGSLHEVKPLSLVVGLIDELRKRHPDLDENLI
SDVILGCVSPVGDQGGDIARAAVLASGMPVTSGGVQLNRFCASGLEAVNTAAQKVRSGWD
DLVLAGGVESMSRVPMGSDGGAMGLDPATNYDVMFVPQSIGADLIATIEGFSREDVDAYA
LRSQQKAAEAWSGGYFAKSVVPVRDQNGLLILDHDEHMRPDTTKEGLAKLKPAFEGLAAL
GGFDDVALQKYHWVEKINHVHTGGNSSGIVDGAALVMIGSAAAGKLQGLTPRARIVATAT
SGADPVIMLTGPTPATRKVLDRAGLTVDDIDLFELNEAFASVVLKFQKDLNIPDEKLNVN
GGAIAMGHPLGATGAMILGTMVDELERRNARRALITLCIGGGMGVATIIERV
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
gtggaatttgtggaacaggaaatcgacatgtccgaagaagccttcatctacgaggccatc
cgcaccccgcgcggcaaacaaaagaacggatcgttgcacgaagtcaagccattgagcctg
gtcgtcggcctgatcgacgagctgcgcaagcgccatcccgacctcgacgagaacctgatc
agcgacgtcatcttgggctgcgtctcaccggtgggcgaccagggcggcgacatcgcccgc
gccgcagtgctggcatcgggcatgccggtcacctccggcggtgtgcagctcaaccggttc
tgcgcgtccggcctggaggccgtcaacaccgccgcgcagaaggtgcgttcgggctgggat
gacctggtgctggccggcggcgtggagtcgatgagccgggtgccgatgggctccgacggc
ggcgctatgggcctggacccggcgaccaactacgacgtcatgttcgtcccgcagagcatc
ggcgccgacctgatcgccaccatcgagggcttctcccgcgaagacgtcgacgcctacgcg
ctacgcagccagcaaaaggccgccgaggcgtggtcgggcggctacttcgccaagtcggtg
gtgccggtgcgcgaccagaacggcctgctgatcctcgatcatgacgaacacatgcggccg
gacaccaccaaggagggtctggccaagctgaagccggccttcgaaggcctggccgcgctg
ggcggtttcgacgacgtggcgctgcagaagtaccactgggtggaaaagatcaaccacgta
cacaccggcggcaacagctcggggatcgtcgacggtgccgcgctggtgatgatcggttcc
gcggccgccggcaagttgcagggcctgactccgcgggcgcgcatcgtcgccaccgccacc
agcggcgccgacccggtgatcatgctcaccggccccaccccggccacccgcaaggtgctc
gaccgcgccgggctgaccgtcgacgacatcgacctgttcgagctcaacgaggcgttcgcg
tcggtggtgctgaagttccagaaggacctcaacattcccgacgagaagctcaacgtcaac
ggtggcgccatcgcgatgggccacccgctgggtgccaccggcgcgatgatcctgggcacc
atggtcgacgaactggagcgccgcaacgcccgacgtgcactcatcacgctgtgcatcggg
ggcggcatgggtgtcgcgacgatcatcgagagggtttaa

DBGET integrated database retrieval system