KEGG   Mycobacterium tuberculosis EAI5: M943_05660Help
Entry
M943_05660        CDS       T02749                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mtx  Mycobacterium tuberculosis EAI5
Pathway
mtx00071  Fatty acid degradation
mtx00072  Synthesis and degradation of ketone bodies
mtx00280  Valine, leucine and isoleucine degradation
mtx00310  Lysine degradation
mtx00362  Benzoate degradation
mtx00380  Tryptophan metabolism
mtx00620  Pyruvate metabolism
mtx00630  Glyoxylate and dicarboxylate metabolism
mtx00640  Propanoate metabolism
mtx00650  Butanoate metabolism
mtx00900  Terpenoid backbone biosynthesis
mtx01100  Metabolic pathways
mtx01110  Biosynthesis of secondary metabolites
mtx01120  Microbial metabolism in diverse environments
mtx01130  Biosynthesis of antibiotics
mtx01200  Carbon metabolism
mtx01212  Fatty acid metabolism
mtx02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mtx00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    M943_05660
   00630 Glyoxylate and dicarboxylate metabolism
    M943_05660
   00640 Propanoate metabolism
    M943_05660
   00650 Butanoate metabolism
    M943_05660
  Lipid metabolism
   00071 Fatty acid degradation
    M943_05660
   00072 Synthesis and degradation of ketone bodies
    M943_05660
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    M943_05660
   00310 Lysine degradation
    M943_05660
   00380 Tryptophan metabolism
    M943_05660
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    M943_05660
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    M943_05660
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    M943_05660
Enzymes [BR:mtx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     M943_05660
Exosome [BR:mtx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   M943_05660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGQ34541
Position
complement(1196805..1198037)
Genome map
AA seq 410 aa AA seqDB search
MPGAVMPEAVIVSTARSPIGRAMKGSLVGMRPDDLAVQMVRAALDKVPALNPHQIDDLMM
GCGLPGGESGFNIARVVAVALGYDFLPGTTVNRYCSSSLQTTRMAFHAIKAGEGDAFISA
GVEAVSRFAKGNSDSWPDTKNPLFDGAQERSAAAAAGADEWHDPRTDQKLPDIYIAMGQT
AENVAIMTGISREEQDRWGVRSQNRAEEAIKNGFFEREITPVTLPDGTTVSTDDGPRPGT
TYEKVSELKPAFRPNGTVTAGNACPLNDGAAAVVITSDTKAKELGLTPLARIVSTGVSGL
SPEIMGLGPIEASKKALERAGMAITDIDLVEINEAFAVQVLGSARELGIDEDKLNISGGA
IALGHPFGMTGARITTTLLNNLQTYDKTFGLETMCVGGGQGMAMVIERLA
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgccgggagccgtcatgccagaagctgtcatcgtctcgactgcccgctcgccgattggc
cgggccatgaaaggatcgctggtcggcatgcggcccgacgacctggccgtccagatggtg
cgcgccgcgctcgacaaggttccggcactgaacccccatcagatcgacgacctcatgatg
ggctgtggcctgccaggcggtgagtccggtttcaacatcgcccgtgtcgtcgccgtcgcg
ctcggctatgacttcctgccgggcaccacggtcaaccggtactgttcgtcgtcgctgcag
accacccggatggccttccacgcgatcaaggccggtgagggcgacgcgttcatctccgcg
ggcgtggaagccgtctcccggttcgccaagggaaactccgactcctggccggacaccaag
aacccgctgttcgacggggctcaggaacgttcggccgcggcagccgccggcgccgacgaa
tggcacgatccccgcaccgatcagaagctgccggacatctatattgcgatgggccagacc
gcggaaaacgtcgccatcatgaccggcatcagccgcgaagaacaggaccgctggggcgtg
cgcagccagaaccgggccgaagaggcgatcaagaacgggttcttcgaacgagaaatcacg
ccggtcacccttccggacggcaccacggtcagcaccgacgacggcccgcgaccgggtacc
acctacgaaaaggtcagcgagctcaagccggctttccggccgaatggcaccgtgaccgcg
gggaatgcctgtccgctcaacgacggggccgccgcggtggtgatcaccagcgacaccaag
gccaaggaattaggcttgacaccgctggcgcgcattgtgtccaccggggtcagcgggctg
tccccggagatcatgggcttagggccgatcgaggcgtccaagaaggcgctggaaagagcc
gggatggcgatcaccgacatcgacctggtcgagatcaacgaggccttcgcggtgcaggtc
ctgggctcggcgcgcgagctgggcatcgacgaggacaagctcaacatctcaggtggcgcg
atcgccctaggtcacccgttcggtatgacgggcgcgcgcatcaccaccacgctgttgaac
aacctgcagacctacgacaagacgttcggtctggaaaccatgtgtgtcggtggcggccag
ggcatggcgatggtgatcgagcgcctcgcgtga

DBGET integrated database retrieval system