KEGG   Mycobacterium tuberculosis EAI5: M943_07585Help
Entry
M943_07585        CDS       T02749                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
mtx  Mycobacterium tuberculosis EAI5
Pathway
mtx00030  Pentose phosphate pathway
mtx00480  Glutathione metabolism
mtx01100  Metabolic pathways
mtx01110  Biosynthesis of secondary metabolites
mtx01120  Microbial metabolism in diverse environments
mtx01130  Biosynthesis of antibiotics
mtx01200  Carbon metabolism
Module
mtx_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
mtx_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:mtx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    M943_07585
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    M943_07585
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mtx04147]
    M943_07585
Enzymes [BR:mtx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     M943_07585
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     M943_07585
Exosome [BR:mtx04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   M943_07585
  Exosomal proteins of colorectal cancer cells
   M943_07585
  Exosomal proteins of bladder cancer cells
   M943_07585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AGQ34879
Position
complement(1622717..1624261)
Genome map
AA seq 514 aa AA seqDB search
MKPAHAAASWRNPLRDKRDKRLPRIAGPCGMVIFGVTGDLARKKVMPAVYDLANRGLLPP
TFSLVGFARRDWSTQDFGQVVYNAVQEHCRTPFRQQNWDRLAEGFRFVPGTFDDDDAFAQ
LAETLEKLDAERGTGGNHAFYLAIPPKSFPVVCEQLHKSGLARPQGDRWSRVVIEKPFGH
DLASARELNKAVNAVFPEEAVFRIDHYLGKETVQNILALRFANQLFDPIWNAHYVDHVQI
TMAEDIGLGGRAGYYDGIGAARDVIQNHLMQLLALTAMEEPVSFHPAALQAEKIKVLSAT
RLAEPLDQTTSRGQYAAGWQGGEKVVGLLDEEGFAEDSTTETFAAITLEVDTRRWAGVPF
YLRTGKRLGRRVTEIALVFRRAPHLPFDATMTDELGTNAMVIRVQPDEGVTLRFGSKVPG
TAMEVRDVNMDFSYGSAFAEDSPEAYERLILDVLLGEPSLFPVNAEVELAWEILDPALEH
WAAHGTPDAYEAGTWGPESSLEMLRRTGREWRRP
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccggcccacgccgcggcgtcgtggcgcaacccgctacgagacaagcgggacaag
cgattacccagaatcgccggcccgtgcggcatggtgattttcggcgtcaccggcgacctg
gcccgcaagaaggtgatgccggccgtctacgatttggccaaccgcggcctgctgccgccc
acattctcgctggtggggtttgcccgccgagactggagcacccaggatttcggtcaagtg
gtgtacaacgccgtccaagagcactgccgaacaccgtttcggcaacagaactgggaccgg
ctggccgagggattccgttttgtgccaggcactttcgacgacgacgacgcgttcgcccaa
ctcgccgagacgctggagaagctcgacgccgagcgcggcaccggcggcaaccacgccttc
tacctggcgatcccgcccaaatccttcccggtggtgtgtgagcagctgcacaagtccggc
ctggcccgcccgcaaggcgaccggtggagccgagtcgtgatagagaagccgttcggccac
gacctggccagcgcacgcgagctgaacaaggcggtcaacgcggtcttcccggaggaagcg
gtcttccgcatcgaccactacctgggcaaagagacggtgcagaacatcctggcgctgcgg
ttcgccaaccagctgttcgacccgatctggaatgcgcactacgtcgaccacgtacagatc
accatggccgaagacatcggcctgggcgggcgcgcgggctattacgacggcatcggcgcg
gcccgcgatgtcatccagaaccatctcatgcagctgctggcgctgaccgcgatggaggag
ccggtcagcttccacccggcagcgttgcaggccgagaagatcaaggtgctctcggccacc
cgccttgccgagccactcgaccagaccaccagccgcggccagtacgccgccggctggcaa
ggcggggagaaggtggttgggctgctcgacgaggaggggttcgccgaggactccaccacc
gaaaccttcgccgctatcaccctggaagtcgatacgcgccggtgggccggcgtgccgttc
tatctgcgaacgggaaaacgattgggccgccgggtgaccgagatcgctctggtcttcagg
cgggcgccgcatctgccgttcgacgccaccatgaccgacgagctgggcaccaacgcgatg
gtcatccgcgtgcagcccgacgaaggtgtcacattgcggttcggctccaaggtgccgggc
accgccatggaagtccgcgacgtcaacatggacttctcctacggctcggcattcgccgaa
gattcaccggaggcctacgagcggctcatcctcgacgtcctgctcggcgagccctcgctg
tttccggtcaacgcggaggtcgaactggcgtgggagatcctcgatccagcgttggaacat
tgggcggcacacgggacgcccgacgcctacgaggcaggtacctggggtccggaatcatcc
ttggagatgctgcgccgcaccggccgggaatggcggcggccatag

DBGET integrated database retrieval system