KEGG   Mycobacterium tuberculosis EAI5: M943_12930Help
Entry
M943_12930        CDS       T02749                                 

Definition
(GenBank) succinyl-CoA:3-ketoacid-CoA transferase
  KO
K01028  3-oxoacid CoA-transferase subunit A [EC:2.8.3.5]
Organism
mtx  Mycobacterium tuberculosis EAI5
Pathway
mtx00072  Synthesis and degradation of ketone bodies
mtx00280  Valine, leucine and isoleucine degradation
mtx00650  Butanoate metabolism
mtx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    M943_12930
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    M943_12930
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    M943_12930
Enzymes [BR:mtx01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     M943_12930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans
Motif
Other DBs
NCBI-ProteinID: AGQ35776
Position
complement(2806911..2807657)
Genome map
AA seq 248 aa AA seqDB search
MDKVVATAAEAVADIANGSSLAVGGFGLCGIPEALIAALVDSGVTDLETVSNNCGIDGVG
LGLLLQHKRIRRTVSSYVGENKEFARQFLAGELEVELTPQGTLAERLRAGGMGIPAFYTP
AGVGTQVADGGLPWRYDASGGVAVVSPAKETREFDGVTYVLERGIRTDFALVHAWQGDRH
GNLMYRHAAANFNPECASAGRITIAEVEHLVEPGEIDPATVHTPGVFVHRVVHVPNPAKK
IERETVRQ
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggacaaggtggtggccaccgccgcggaggcggtcgcagacatagccaacgggtcgtcg
cttgcggttggtggattcgggctttgcggcatccccgaagcactgatcgcagcgttggtg
gatagcggtgtcaccgacctggaaacagtctcgaacaactgcggaatcgacggtgttggt
ctgggactattgttgcaacacaagcgaattcgccggacagtctcctcctacgtgggggag
aacaaggagttcgcccgccagttcctcgcgggcgagctcgaggtggaactgaccccgcag
ggcacgctggccgagcggttgcgggccggagggatgggcataccggccttctatacaccg
gcaggggtcggtacccaggtcgccgacggcgggttgccgtggcgctacgacgcctcgggc
ggggtggcggtggtgtcgccggccaaggagactcgggagttcgatggtgtcacctatgtc
ctcgagcgggggatccggaccgacttcgcactggtgcatgcctggcagggggaccggcac
ggcaacctgatgtaccgccacgccgcggccaacttcaacccggagtgcgcatccgcaggc
aggatcacgatcgccgaggtcgagcacttggtcgagccgggtgagatcgaccctgccacc
gtacacaccccgggcgtgtttgtgcaccgggtggttcatgtgcccaaccccgccaagaag
atcgagagggagacggtgcggcaatga

DBGET integrated database retrieval system