KEGG   Mycobacterium tuberculosis EAI5: M943_16355Help
Entry
M943_16355        CDS       T02749                                 

Definition
(GenBank) monooxygenase
  KO
K00274  monoamine oxidase [EC:1.4.3.4]
Organism
mtx  Mycobacterium tuberculosis EAI5
Pathway
mtx00260  Glycine, serine and threonine metabolism
mtx00330  Arginine and proline metabolism
mtx00340  Histidine metabolism
mtx00350  Tyrosine metabolism
mtx00360  Phenylalanine metabolism
mtx00380  Tryptophan metabolism
mtx01100  Metabolic pathways
mtx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtx00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    M943_16355
   00330 Arginine and proline metabolism
    M943_16355
   00340 Histidine metabolism
    M943_16355
   00350 Tyrosine metabolism
    M943_16355
   00360 Phenylalanine metabolism
    M943_16355
   00380 Tryptophan metabolism
    M943_16355
Enzymes [BR:mtx01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     M943_16355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox_2 FAD_binding_2 Pyr_redox FAD_oxidored Thi4 Pyr_redox_3 HI0933_like FAD_binding_3 GIDA Lycopene_cycl NAD_binding_9 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AGQ36360
Position
3524929..3526275
Genome map
AA seq 448 aa AA seqDB search
MTNPPWTVDVVVVGAGFAGLAAARELTRQGHEVLVFEGRDRVGGRSLTGRVAGVPADMGG
SFIGPTQDAVLALATELGIPTTPTHRDGRNVIQWRGSARSYRGTIPKLSLTGLIDIGRLR
WQFERIARGVPVAAPWDARRARELDDVSLGEWLRLVRATSSSRNLMAIMTRVTWGCEPDD
VSMLHAARYVRAAGGLDRLLDVKNGAQQDRVPGGTQQIAQAAAAQLGARVLLNAAVRRID
RHGAGVTVTSDQGQAEAGFVIVAIPPAHRVAIEFDPPLPPEYQQLAHHWPQGRLSKAYAA
YSTPFWRASGYSGQALSDEAPVFITFDVSPHADGPGILMGFVDARGFDSLPIEERRRDAL
RCFASLFGDEALDPLDYVDYRWGTEEFAPGGPTAAVPPGSWTKYGHWLREPVGPIHWAST
ETADEWTGYFDGAVRSGQRAAAEVAALL
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaacccaccgtggactgtcgatgttgtcgtggtgggcgcgggcttcgccgggctg
gccgcggcccgcgagctgacgcgacagggtcacgaggtgctggtgttcgaaggccgcgat
cgggtgggcggccgctcgttaaccggtcgcgtggcaggggtgcccgcggatatgggcggc
tcgttcatcggcccgacccaagacgccgtgctggcgttggccaccgagctggggatcccg
acaaccccgacccaccgcgacggccgaaacgtcatccagtggcggggatcggcacgcagc
tatcgtggcaccatccccaagctgtcgctgaccgggctcatcgacatcggccggttgcgt
tggcaattcgagcgaattgcccgcggcgttccggtggccgccccctgggatgcgcggcgc
gcgcgtgaactcgacgacgtgtcgctcggggagtggttgcgcttggtgcgcgccacatcg
tcctcgcggaacctgatggccatcatgacccgggtgacctggggttgtgagcccgacgat
gtctcgatgctgcacgccgcccgctacgtacgcgcggccggcggcctggaccggctgctc
gacgtcaaaaatggtgcccagcaggaccgtgtgccgggggggacacagcagatcgcccag
gcggccgccgcccaactcggcgcacgcgtcctgctcaacgccgcggtgcgtcgcatcgac
cggcacggagcgggtgtgacggtcacgtccgatcagggtcaggccgaggccgggttcgtc
atcgtcgccattccaccggcccatcgcgtggccatcgagttcgatcccccgctgccgccg
gaatatcagcagctcgcccaccattggccgcagggccggctgagcaaggcctacgcggcc
tattcgacgccgttctggcgggccagcgggtattccggccaggcgctgtccgatgaggcg
ccggtgttcatcaccttcgacgtcagtccgcacgccgacgggccaggcattctgatgggg
ttcgtcgatgctcgcgggttcgactcgctacccatcgaagagcgccgccgcgatgcattg
cgctgctttgcgtcgctgttcggcgacgaagcgctcgacccccttgattatgttgactat
cgttggggtacagaggaattcgcgccgggtggtccgaccgcggcggtaccgccggggtcg
tggacgaaatacggtcactggttacgtgagccggtcggtccgattcactgggcgagcact
gagaccgcggacgaatggaccgggtatttcgacggcgccgtcagatccggtcagcgtgcc
gccgccgaggtcgccgccctgctatga

DBGET integrated database retrieval system