KEGG   Mycobacterium tuberculosis EAI5: M943_19020Help
Entry
M943_19020        CDS       T02749                                 

Definition
(GenBank) amidohydrolase
  KO
K07008  gamma-glutamyl hercynylcysteine S-oxide hydrolase [EC:3.5.1.118]
Organism
mtx  Mycobacterium tuberculosis EAI5
Pathway
mtx00340  Histidine metabolism
mtx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    M943_19020
Enzymes [BR:mtx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.118  gamma-glutamyl hercynylcysteine S-oxide hydrolase
     M943_19020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_6 GATase_4
Motif
Other DBs
NCBI-ProteinID: AGQ36821
Position
complement(4124547..4125248)
Genome map
AA seq 233 aa AA seqDB search
MCRHLGWLGAQVAVSSLVLDPPQGLRVQSYAPRRQKHGLMNADGWGVGFFDGAIPRRWRS
PAPLWGDTSFHSVAPALRSHCILAAVRSATVGMPIEVSATPPFTDGHWLLAHNGVVDRAV
LPAGPAAESVCDSAILAATIFAHGLDALGDTIVKVGAADPNARLNILAANGSRLIATTWG
DTLSILRRADGVVLASEPYDDDSGWGDVPDRHLVEVTQKGVTLTALDRAKGPR
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgtgtcgtcacctggggtggctcggggcacaggtcgcggtttcttcgttggtgctggac
ccgccgcagggtctgcgggtgcagtcatatgcgccgcgtcggcaaaagcacgggctgatg
aacgccgacggttggggtgtcggcttcttcgacggtgccattccccggcgttggcgcagc
ccggctccgctgtggggggacacgtcgtttcactcggtggcgccggcgctgcgtagtcac
tgcatcctcgccgcggtgcgctcggcgactgtcggtatgccgatcgaagtcagcgcgacc
ccgccgttcaccgatgggcactggttgctagcgcacaacggtgtggttgatcgtgccgtg
ttgccggcgggcccggcggccgaatcggtctgtgacagcgcgatactcgcggccaccatc
ttcgctcacggtctggacgctctgggagacaccattgtcaaggtcggcgcggccgaccca
aatgcccgactaaacatcttggcggccaacggttcccggctcatcgcgaccacctgggga
gacacgctgtccatcctgcggcgcgccgacggggtggtgctggccagcgaaccatacgac
gacgactccggttggggcgacgtgccggaccgccacctggtggaggtaacccaaaagggt
gtcacgctgaccgcattggaccgcgcgaaaggacctcgatga

DBGET integrated database retrieval system