KEGG   Mycobacterium tuberculosis KZN 605: TBXG_000436Help
Entry
TBXG_000436       CDS       T02141                                 

Definition
(GenBank) phosphatidylserine decarboxylase psd
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
mtz  Mycobacterium tuberculosis KZN 605
Pathway
mtz00564  Glycerophospholipid metabolism
mtz01100  Metabolic pathways
mtz01110  Biosynthesis of secondary metabolites
Module
mtz_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:mtz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    TBXG_000436
Enzymes [BR:mtz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     TBXG_000436
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase DUF4131
Motif
Other DBs
NCBI-ProteinID: AFM47820
Position
complement(525647..526342)
Genome map
AA seq 231 aa AA seqDB search
MARRPRPDGPQHLLALVRSAVPPVHPAGRPFIAAGLAIAAVGHRYRWLRGTGLLAAAACA
GFFRHPQRVPPTRPAAIVAPADGVICAIDSAAPPAELSMGDTPLPRVSIFLSILDAHVQR
APVSGEVIAVQHRPGRFGSADLPEASDDNERTSVRIRMPNGAEVVAVQIAGLVARRIVCD
AHVGDKLAIGDTYGLIRFGSRLDTYLPAGAEPIVNVGQRAVAGETVLAECR
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
gtggccagacgcccccgccccgacggcccgcaacatctgctcgccctggtgcggtccgcc
gttccaccggttcatccggccgggcggccgttcattgccgccggccttgcgattgcggcc
gtcggacaccgctaccggtggttgcgcggcacgggtctgctggcggccgctgcctgcgcg
ggcttcttccggcacccgcagcgggtaccgcccaccaggccggctgccattgtcgcgccc
gccgacggcgtgatctgcgcgatcgactcagcggccccaccggccgaactcagcatgggt
gacacgccgttaccgcgagtcagcatcttcctgtcgatattggacgcccacgtgcaacgt
gccccggtgagcggggaagtgatcgccgtgcaacaccggccgggccggttcgggtcggcc
gacctaccggaggcgagcgacgacaacgagcgcaccagtgtgcggatccgcatgcccaac
ggcgccgaggtggtcgcggtgcagatcgccgggctggtggcgcgccgcattgtgtgcgac
gcacacgtcggagacaagctggccatcggtgacacctacggcctgatccggttcggctcc
cggctggatacctacctgccagcgggcgcagagccgatcgtcaacgtcggccagcgcgcg
gtcgccggcgagaccgtgctggccgaatgtcgatga

DBGET integrated database retrieval system