KEGG   Mycobacterium tuberculosis KZN 605: TBXG_001686Help
Entry
TBXG_001686       CDS       T02141                                 

Definition
(GenBank) phosphate-transport permease pitB
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
mtz  Mycobacterium tuberculosis KZN 605
Brite
KEGG Orthology (KO) [BR:mtz00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    TBXG_001686
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AFM49089
Position
complement(1863235..1864893)
Genome map
AA seq 552 aa AA seqDB search
MSDNAKHHRDGHLVASGLQDRAARTPQHEGFLGPDRPWHLSFSLLLAGSFVLFSWWAFDY
AGSGANKVILVLATVVGMFMAFNVGGNDVANSFGTSVGAGTLTMKQALLVAAIFEVSGAV
IAGGDVTETIRSGIVDLSGVSVDPRDFMNIMLSALSAAALWLLFANRMGYPVSTTHSIIG
GIVGAAIALGMVSGQGGAALRMVQWDQIGQIVVSWVLSPVLGGLVSYLLYGVIKRHILLY
NEQAERRLTEIKKERIAHRERHKAAFDRLTEIQQIAYTGALARDAVAANRKDFDPDELES
DYYRELHEIDAKTSSVDAFRALQNWVPLVAAAGSMIIVAMLLFKGFKHMHLGLTTMNNYF
IIAMVGAAVWMATFIFAKTLRGESLSRSTFLMFSWMQVFTASGFAFSHGSNDIANAIGPF
AAILDVLRTGAIEGNAAVPAAAMVTFGVALCAGLWFIGRRVIATVGHNLTTMHPASGFAA
ELSAAGVVMGATVLGLPVSSTHILIGAVLGVGIVNRSTNWGLMKPIVLAWVITLPSAAIL
ASVGLVALRAIF
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacaatgccaaacaccacagggatgggcatttggtggctagcggacttcaggat
cgcgcagcgcgcacaccgcaacacgagggcttcctcgggccggaccgaccatggcacctg
tcgttcagtctgctgctggcgggttctttcgtgctgttctcgtggtgggcattcgactac
gcagggtccggcgcgaacaaagtcatcctggtgctcgccaccgtcgtcggcatgttcatg
gccttcaacgtcggcggcaatgatgtcgccaactcgtttggcaccagcgtcggcgcgggc
acgttgaccatgaaacaggcgcttctggtcgcggcgatcttcgaggtcagcggcgcggtg
atcgccggcggcgacgtcaccgagaccatccgcagcggcatcgttgatctgtccggggtg
tccgtcgacccacgcgacttcatgaacatcatgctgtcggcgctatcggcagccgcgctc
tggctgctgtttgctaaccgtatggggtacccggtgtcgaccacacactcgatcatcggc
ggcatcgtcggcgcggcgatcgcgctggggatggtgagcggccagggcggtgccgcactc
aggatggtccagtgggatcaaatcggccagatcgtggtgtcctgggtgctgtcgccggtg
ttgggcggcttggtgtcgtacctgctctacggcgtcatcaaacggcacatcctgctgtac
aacgaacaggccgaacgacggctaacagaaattaagaaagagcgcatcgcacaccgcgag
cgccacaaggcggcgttcgaccggctcaccgagatccagcagatcgcctataccggcgcc
ctggcgcgcgacgccgtcgcggcaaaccgcaaggactttgatcccgacgaactggaatcc
gattactaccgcgagctacacgaaatcgacgccaagacatcgtcggtcgacgcgttccgg
gccctgcagaactgggttccgctggtcgccgccgccggatccatgatcattgtcgcgatg
ctgctgttcaaggggttcaagcacatgcacttgggccttaccacgatgaataactacttc
atcatcgcgatggtcggtgcagcggtgtggatggccacctttattttcgccaagacactt
cggggcgaatcactttcacggtcaacgtttttgatgttcagctggatgcaggtctttacg
gcctcgggcttcgccttcagccacggcagcaatgacattgccaacgccatcgggccgttc
gcggcaatcctggatgtgctgcgcacgggcgccattgaaggcaacgcagcggtgcctgcc
gcggccatggtaacgttcggcgtcgcgttgtgcgcggggttgtggttcattggacgacgg
gtgatcgccaccgttggacacaacctcaccacgatgcacccggcatcggggtttgctgcc
gaattgtcggccgccggggtggtcatgggagccacggtcctgggtcttccggtttccagc
acgcacattcttatcggcgccgtcctcggcgtcggcatcgtaaaccggtccaccaactgg
ggactgatgaaaccgatcgtgctagcgtgggtcatcacgctgccttcggcggcgatcctc
gcctcggtcggtcttgtcgcgctacgcgcgattttctga

DBGET integrated database retrieval system