KEGG   Mycobacterium tuberculosis KZN 605: TBXG_002034Help
Entry
TBXG_002034       CDS       T02141                                 

Definition
(GenBank) riboflavin biosynthesis protein ribA1
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
mtz  Mycobacterium tuberculosis KZN 605
Pathway
mtz00740  Riboflavin metabolism
mtz00790  Folate biosynthesis
mtz01100  Metabolic pathways
mtz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    TBXG_002034
   00790 Folate biosynthesis
    TBXG_002034
Enzymes [BR:mtz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     TBXG_002034
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     TBXG_002034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: AFM49443
Position
complement(2229287..2230348)
Genome map
AA seq 353 aa AA seqDB search
MKTTDVRVRRAITAMAGGHAVVLTGDPNGDGYLVFAAQAATPRLVAFAVRHTSGYLRVAL
PGAECERLHLPPMCDRDTTHCVSVDVRGTGTGISASDRAWTIAALASATSVAADFQRPGH
VVPVQAQADGVLGRRGPAEAAVDLARLAERRPAAALCEIVSPDNPVQMAHHAESVEFAVE
HGLAMVSIGELVAYRRRIEPQVVRFTAATLPTWAGASRVIGFRDVYDLGEHLAVIVGAVG
AGVPVPLHVHIECLTGDVFGSTACRCGEELNGALARMSAQGSGVVLYLRPPGPAQACGLF
ARGDAATDVMPETVTWILRDLGVYAIRLSDDVPGFGLVMFGAIREASTLAAAG
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgaccgatgtgcgggtacgtcgtgcgatcacggcgatggcgggcggtcacgcc
gtggtcctgaccggcgaccccaatggcgatggctatctcgtcttcgccgcccaggccgcg
acgccgcggctggttgcctttgcggtccggcacacctcgggttatttgcgcgtcgcgctg
ccgggcgccgaatgcgagcgactgcacctgccgcccatgtgtgaccgagacaccacgcat
tgcgtgtcggtcgacgttcgcggcaccggcaccggaatctcggcgagcgatcgcgcctgg
accatcgcggcactggcttcggccacctccgtcgccgccgatttccaacgtccgggccat
gtggtgcccgtgcaggcgcaagccgacggtgtgctgggtcggcggggacccgccgaggcg
gccgtcgacctggcccgcctggcggaacggcggccggccgccgcgctctgcgagatcgtc
tcgcccgataatcccgtccagatggcgcaccacgccgagtcggtcgaattcgccgtcgaa
cacggactggccatggtctcgatcggggagctggtggcgtatcgccggcggatcgagccc
caggtggtccggtttacggcagcgacgctgcccacctgggccggcgcctcgcgtgtcatc
ggctttcgtgacgtttacgacctcggcgagcatttggcggtcatcgtgggtgcggtcggt
gccggggtgcccgtgccgctgcacgtccacatcgagtgcctgacgggcgacgtgttcggc
tcgacggcgtgccgctgcggcgaggaactcaacggcgcgctggcgaggatgtcggctcag
ggcagcggcgtggtcttgtatctgcgtccgcccggacccgcgcaagcgtgcggcttgttc
gcccggggcgatgcggcgaccgatgtcatgccggagaccgtgacatggatcctgcgcgat
cttggggtgtatgcgatccgactttccgatgatgtgccaggatttgggcttgtcatgttc
ggggcgatccgagaagccagcacgttggcggccgcaggttga

DBGET integrated database retrieval system