KEGG   Mycobacterium tuberculosis KZN 605: TBXG_002363Help
Entry
TBXG_002363       CDS       T02141                                 

Definition
(GenBank) tryptophan synthase, alpha subunit trpA
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mtz  Mycobacterium tuberculosis KZN 605
Pathway
mtz00260  Glycine, serine and threonine metabolism
mtz00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mtz01100  Metabolic pathways
mtz01110  Biosynthesis of secondary metabolites
mtz01130  Biosynthesis of antibiotics
mtz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtz00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TBXG_002363
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TBXG_002363
Enzymes [BR:mtz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TBXG_002363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth BtpA
Motif
Other DBs
NCBI-ProteinID: AFM49771
Structure
PDB: 

Position
complement(2609424..2610236)
Genome map
AA seq 270 aa AA seqDB search
MVAVEQSEASRLGPVFDSCRANNRAALIGYLPTGYPDVPASVAAMTALVESGCDIIEVGV
PYSDPGMDGPTIARATEAALRGGVRVRDTLAAVEAISIAGGRAVVMTYWNPVLRYGVDAF
ARDLAAAGGLGLITPDLIPDEAQQWLAASEEHRLDRIFLVAPSSTPERLAATVEASRGFV
YAASTMGVTGARDAVSQAAPELVGRVKAVSDIPVGVGLGVRSRAQAAQIAQYADGVIVGS
ALVTALTEGLPRLRALTGELAAGVRLGMSA
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggtggcggtggaacagagcgaagcaagtaggctcgggccggttttcgattcctgccgt
gcaaacaaccgcgcggcattgattggttacttgccgaccgggtacccggacgtgccagcg
tcggtggccgcgatgacagcgctagttgaatccggttgcgacattatcgaagtcggggtt
ccgtattcggacccgggcatggacggccccaccatcgccagggcaaccgaggcggcgctc
cgtggcggggtgcgagtccgggatacgttagccgcggtcgaggccatcagtatcgccggc
gggcgtgcggtagtgatgacctactggaatccggtgctgcgctatggggttgatgcattc
gcgcgggatctggcggcggccggaggactcggcctgatcactcctgacctcattcccgac
gaggcgcaacagtggctggcggcatccgaagagcatcggttggatcgcattttcttggtc
gcgccgtcctcgacaccggagcggttggcggccaccgtcgaggcttcacgcgggttcgtc
tacgcggcgtcgacgatgggggtgaccggggcgcgggatgcggtgtcgcaggcggcaccc
gaactggtgggccgggtgaaggcggtgtctgacataccggtgggcgtcggtctgggtgtg
cggtcgcgcgctcaagccgcgcagatcgcccaatacgccgacggtgtcatcgttggttcc
gcattggtgacggcgctaaccgaggggttgcctagattgcgggcactgaccggagagctc
gctgccggggtacgactagggatgtccgcatga

DBGET integrated database retrieval system