KEGG   Mycobacterium tuberculosis KZN 605: TBXG_002780Help
Entry
TBXG_002780       CDS       T02141                                 

Definition
(GenBank) polyketide synthase associated protein papA3
  KO
K23156  mycolipenoyl-CoA---2-(long-chain-fatty acyl)-trehalose mycolipenoyltransferase / long-chain-acyl-CoA---trehalose acyltransferase [EC:2.3.1.278 2.3.1.279]
Organism
mtz  Mycobacterium tuberculosis KZN 605
Brite
KEGG Orthology (KO) [BR:mtz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    TBXG_002780
Enzymes [BR:mtz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.278  mycolipenoyl-CoA---2-(long-chain-fatty acyl)-trehalose mycolipenoyltransferase
     TBXG_002780
    2.3.1.279  long-chain-acyl-CoA---trehalose acyltransferase
     TBXG_002780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Condensation
Motif
Other DBs
NCBI-ProteinID: AFM50191
Position
complement(3090612..3092030)
Genome map
AA seq 472 aa AA seqDB search
MLRVGPLTIGTLDDWAPSTGSTVSWRPSAVAHTKASQAPISDVPVSYMQAQHIRGYCEQK
AKGLDYSRLMVVSCQQPGQCDIRAANYVINAHLRRHDTYRSWFQYNGNGQIIRRTIQDPA
DIEFVPVHHGELTLPQIREIVQNTPDPLQWGCFRFGIVQGCDHFTFFASVDHVHVDAMIV
GVTLMEFHLMYAALVGGHAPLELPPAGSYDDFCRRQHTFSSTLTVESPQVRAWTKFAEGT
NGSFPDFPLPLGDPSKPSDADIVTVMMLDEEQTAQFESVCTAAGARFIGGVLACCGLAEH
ELTGTTTYYGLTPRDTRRTPADAMTQGWFTGLIPITVPIAGSAFGDAARAAQTSFDSGVK
LAEVPYDRVVELSSTLTMPRPNFPVVNFLDAGAAPLSVLLTAELTGTNIGVYSDGRYSYQ
LSIYVIRVEQGTAVAVMFPDNPIARESVARYLATLKSVFQRVAESGQQQNVA
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgggttggaccgttgacaataggcacgctggacgactgggcgccgagcacgggt
tcgactgtgtcatggcgaccttcggctgtcgcgcacacgaaagcgtcgcaggcgccgatc
agcgatgttccggtcagttatatgcaggcgcaacatattcggggctattgcgagcaaaag
gcaaagggactcgactactcgcggttgatggtcgtcagctgccagcagcccggccagtgc
gatatccgggcggccaactacgtgatcaacgcccatctccgacggcacgatacctatcgc
agctggttccaatacaacggcaacggacaaataatccggcgtacgatccaggatcccgcc
gacatcgagttcgtaccagttcatcatggtgagctcacgctgccgcaaattcgcgagatc
gtgcagaacacgccggatcccctgcaatggggttgttttcggtttgggatcgtgcaaggc
tgcgaccatttcacattctttgcaagtgtggatcatgtgcatgtggacgcgatgatcgtc
ggtgtcacgctcatggagttccacctgatgtacgcagcgctggtgggcggccatgcccct
ctcgagctaccgccggcaggcagctacgacgacttctgccgccgacaacacacgttcagc
tccaccctcacggtggagtcgccccaggttcgcgcctggacgaagttcgccgaaggtact
aacggtagctttcctgattttccactcccacttggtgacccatcgaaacccagtgacgcg
gatattgtcaccgtgatgatgctcgatgaagagcagacggctcaattcgagtccgtctgc
acggctgccggcgctcggttcatcggtggcgtactagcctgctgcggcctggctgaacac
gagttgaccggtacgacaacctattacggactaacgccgcgcgacacgcgccgcactcca
gcggatgccatgacccaaggttggttcaccggcctaattccgatcaccgtccccatcgcc
ggctcggcgttcggcgatgccgcccgagccgcgcagacctcgttcgactcgggcgtgaag
ctcgccgaagtaccctacgaccgcgtcgtcgaattgtcgtccacgctaaccatgccacga
ccgaactttcccgtcgtcaacttcctcgacgcaggcgcggctccgctttcggtactgctc
accgcggagttaaccggtacgaacataggagtgtacagcgacggtcgctactcttatcaa
ctgtccatctacgtcatccgcgtcgagcaggggacggcagtggcggtcatgttccccgac
aacccgatcgcccgggaatcggttgcccgctacctggcaacgctgaagtctgtgttccaa
cgagtcgccgagagcgggcagcagcagaatgttgcctga

DBGET integrated database retrieval system