KEGG   Mycobacterium tuberculosis KZN 605: TBXG_003538Help
Entry
TBXG_003538       CDS       T02141                                 

Definition
(GenBank) lipid carrier protein or keto acyl-CoA thiolase ltp3
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mtz  Mycobacterium tuberculosis KZN 605
Pathway
mtz00071  Fatty acid degradation
mtz00072  Synthesis and degradation of ketone bodies
mtz00280  Valine, leucine and isoleucine degradation
mtz00310  Lysine degradation
mtz00362  Benzoate degradation
mtz00380  Tryptophan metabolism
mtz00620  Pyruvate metabolism
mtz00630  Glyoxylate and dicarboxylate metabolism
mtz00640  Propanoate metabolism
mtz00650  Butanoate metabolism
mtz00900  Terpenoid backbone biosynthesis
mtz01100  Metabolic pathways
mtz01110  Biosynthesis of secondary metabolites
mtz01120  Microbial metabolism in diverse environments
mtz01130  Biosynthesis of antibiotics
mtz01200  Carbon metabolism
mtz01212  Fatty acid metabolism
mtz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mtz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TBXG_003538
   00630 Glyoxylate and dicarboxylate metabolism
    TBXG_003538
   00640 Propanoate metabolism
    TBXG_003538
   00650 Butanoate metabolism
    TBXG_003538
  09103 Lipid metabolism
   00071 Fatty acid degradation
    TBXG_003538
   00072 Synthesis and degradation of ketone bodies
    TBXG_003538
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TBXG_003538
   00310 Lysine degradation
    TBXG_003538
   00380 Tryptophan metabolism
    TBXG_003538
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TBXG_003538
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TBXG_003538
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    TBXG_003538
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mtz04147]
    TBXG_003538
Enzymes [BR:mtz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     TBXG_003538
Exosome [BR:mtz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TBXG_003538
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M22 Thiolase_N
Motif
Other DBs
NCBI-ProteinID: AFM50969
Position
3945761..3946945
Genome map
AA seq 394 aa AA seqDB search
MAEKLAAVLGTGQTKYVAKRQDVSMNGLVREAIDRALADSGSTFDDIDAVVVGKAPDFFE
GVMMPELFMADAMGATGKPLIRVHTAGSVGGSTGVVAASLVQSGKYRRVLALAWEKQSES
NAMWALSIPVPFTKPVGAGAGGYFAPHVRAYIRRSGAPAHIGAMVAVKDRLNGSRNPLAH
LQQPDITLEKVMASQMLWDPIRFDETCPSSDGACAVVVGDEEIADARLAQGHPVAWIHGT
ALRTEPLAFAGRDQVNPQAGRDAAAALWKAAGITSPIDEIDAAEIYVPFSWFEPMWLENL
GFAREGEGWKLTEAGETAIGGRLPVNPSGGVLSANPIGASGLIRFAEAAIQVMGKAEARQ
VPGARKALGHAYGGGSQYFSMWVVGCEKPKQAAA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaaagctggccgccgtactcggcaccgggcagaccaagtatgtcgccaagcgc
caagacgtttcgatgaacggtctggtgcgggaggccatcgaccgagcgctggcggattcc
ggttccaccttcgacgacatcgacgccgtcgtggtcggcaaggcgcccgacttcttcgaa
ggggtgatgatgccggagctattcatggccgacgccatgggcgcgaccggcaagccgctg
atccgggtacacaccgccggttcggttggcggatccaccggggtagtggctgccagcctg
gtgcaatccggcaaataccgccgggtcctggcattagcctgggaaaagcagtcggaatcc
aatgccatgtgggcgttgtcgattcctgtgccgttcaccaaaccggtcggtgccggtgcg
gggggatacttcgccccgcatgtccgggcctatatccgccgctcgggcgcaccggcacac
atcggtgctatggttgcggtcaaggaccggctcaacggcagccgcaacccgttggcacat
ctgcagcagcccgacatcaccctggagaaggtgatggcatctcagatgctctgggatcca
atacgtttcgatgagacgtgcccgtcgtcagacggtgcgtgcgcggttgtcgtcggcgac
gaggagatcgccgacgcgcgactggcgcaagggcatccggtggcctggattcatggcacc
gcattacgcaccgagccgctggctttcgccgggcgcgaccaggtcaacccgcaggccggc
cgcgacgcggcggcggcgctgtggaaggccgcgggcatcaccagccccatcgacgaaatc
gacgccgccgaaatttacgtcccgttctcctggttcgagccgatgtggttggagaatctg
ggatttgcccgcgagggcgagggctggaagctcaccgaggccggcgagactgcgatcggc
ggtcgactaccggtgaacccttccggcggcgtgctgtccgccaatccgatcggcgcatcg
ggcctgatccgcttcgccgaggccgcgatccaagtcatgggcaaggcggaggcgcgtcaa
gttccgggtgcgcgaaaggccttggggcacgcttacggtggcggctcgcagtacttctct
atgtgggtggtcggctgcgagaaacccaaacaggcagccgcataa

DBGET integrated database retrieval system