KEGG   Mycobacterium tuberculosis KZN 605: TBXG_003583Help
Entry
TBXG_003583       CDS       T02141                                 

Definition
(GenBank) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase bphD
  KO
K16050  4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase [EC:3.7.1.17]
Organism
mtz  Mycobacterium tuberculosis KZN 605
Pathway
mtz00984  Steroid degradation
mtz01100  Metabolic pathways
mtz01120  Microbial metabolism in diverse environments
mtz01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mtz00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    TBXG_003583
Enzymes [BR:mtz01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.17  4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase
     TBXG_003583
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr
Motif
Other DBs
NCBI-ProteinID: AFM51015
Structure
PDB: 

Position
complement(3996425..3997300)
Genome map
AA seq 291 aa AA seqDB search
MTATEELTFESTSRFAEVDVDGPLKLHYHEAGVGNDQTVVLLHGGGPGAASWTNFSRNIA
VLARHFHVLAVDQPGYGHSDKRAEHGQFNRYAAMALKGLFDQLGLGRVPLVGNSLGGGTA
VRFALDYPARAGRLVLMGPGGLSINLFAPDPTEGVKRLSKFSVAPTRENLEAFLRVMVYD
KNLITPELVDQRFALASTPESLTATRAMGKSFAGADFEAGMMWREVYRLRQPVLLIWGRE
DRVNPLDGALVALKTIPRAQLHVFGQCGHWVQVEKFDEFNKLTIEFLGGGR
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgacagctaccgaggaattgacgttcgaatccacctcgcgctttgcggaagtggacgtc
gacgggccgctgaaactgcactaccacgaggccggcgtgggcaacgaccagacggtggtg
ctactgcacggcggtgggcccggcgcggcgagctggacgaacttctcgcgtaatatcgcg
gtgctggcgcggcactttcatgtgctggccgtcgaccagcccggttacggccattccgac
aagcgggccgagcacggccagttcaatcgctatgccgcgatggcgctgaaggggctcttc
gatcagctggggctggggcgggtaccgctggtgggcaactcgttgggcgggggaaccgcg
gtccggtttgcgctggactacccggcccgggcaggacggttagtgctgatgggcccgggg
ggcctgagtatcaacctgtttgcgcccgacccgaccgagggagtcaaacggctgtcgaag
ttctccgttgcgcccacccgggagaacctcgaggcgttcctgcgggtcatggtctacgac
aagaacctgatcacccccgagttggtggatcagcggtttgcgctggccagcaccccggag
tcgttgacggcaacacgggcgatgggaaagtcgttcgccggagccgacttcgaggccggc
atgatgtggcgcgaggtgtatcggctgcgccagccggtgttgctgatctggggtcgtgag
gaccgggtcaacccgctggacggcgcgctggttgcgttgaaaacgattccgcgtgcgcag
ctgcacgtattcgggcagtgtgggcattgggtgcaggtggagaagttcgacgagttcaac
aagctgacgattgaatttctgggaggtggcagatga

DBGET integrated database retrieval system