KEGG   Mucilaginibacter sp. BJC16-A31: MuYL_0050Help
Entry
MuYL_0050         CDS       T05010                                 

Definition
(GenBank) oxygen-independent coproporphyrinogen-3 oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
muc  Mucilaginibacter sp. BJC16-A31
Pathway
muc00860  Porphyrin and chlorophyll metabolism
muc01100  Metabolic pathways
muc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:muc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MuYL_0050
Enzymes [BR:muc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     MuYL_0050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: ASU31953
UniProt: A0A223NQ08
Position
54472..55848
Genome map
AA seq 458 aa AA seqDB search
MFSEENYTTLAQKYNVAAPRYTSYPTVPYWDNANFDAGQWQKAVKFSFDESNATDGISLY
IHLPFCESLCTYCGCNTRITKNHRVEEPYINAVLKEWKMYLQLMDEPPVIREIHLGGGTP
TFFSAVNLHLLIDGILKESVVHPQAEFSFEAHPDNTTVDHLQTLYNLGFKRLSLGIQDFD
PRVQFIINRHQTFEQVQTITQVARGIGYTSINFDLIYGLPLQTMEGLADTMHLVSELSPD
RIAFYSYAHVPWIKPGQRRFTEEHLPNVHDKNKLYEIGRDLLKGYGYIEVGMDHFALPGD
DLLKAEKSGNLHRNFMGYTHQHTQLLIGLGVSSISDSWYAFAQNVKVVEDYLRLVNEGEL
PVVKGHILTHEDLIIRKHILNIMCKGETVWNQHLEQSISLTDAFERLAPLVDDGLIELNA
RNLKVTPLGKNFLRNICMALDARLWADKPTTQLFSMAV
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgttctcagaagaaaactacaccacccttgcacaaaaatataacgtagcagcgccgaga
tacacaagctatcccactgttccttattgggacaacgcaaattttgatgccgggcaatgg
caaaaggctgtcaaattttcatttgatgaaagcaatgcaactgacggaataagcctttat
attcatttgccgttttgcgaaagcctttgcacctactgtggctgcaacacaaggatcaca
aaaaatcatcgggttgaagaaccttatattaatgccgttttaaaagaatggaaaatgtac
ctgcaattgatggacgaacctcctgtaatccgggagatccatttgggcggcggcacacct
actttttttagcgccgttaacctgcatttgcttattgacggaattctgaaagaatccgta
gtgcatccacaggcagaattcagctttgaggcgcatccggacaatacaacggttgatcat
ctgcaaaccttgtacaatcttggctttaagcgccttagcctcggcatccaggattttgat
ccgcgggtacagtttattatcaaccgccatcaaacgtttgagcaggtacagaccataaca
caggttgcccgcggcattggttatacctctatcaacttcgacctgatctatggtctcccc
ttacaaactatggagggacttgccgacacaatgcacctggtatcggaactaagcccggat
cgcatcgccttttacagctatgcgcatgtgccctggattaagcctggccaaaggcgattt
acagaggagcatttacccaacgtacatgataaaaataagttatatgaaattggccgcgac
ctgcttaagggctatggatacattgaagtggggatggaccattttgcactgcccggagat
gatcttctaaaagctgaaaaatcaggcaacctgcaccgcaatttcatgggttacacccat
cagcacacccagctgttaattggcctgggggtatcatccatcagcgattcatggtatgcc
tttgcacagaatgtaaaagtggttgaagattacctgcgcctggttaatgagggcgagctg
cctgttgttaaaggccatattttaacacatgaggacctcatcatccgcaagcatatttta
aatataatgtgcaaaggcgaaacggtttggaaccagcatctggaacaatccatctcatta
acggatgcctttgaacgattagcgcctttggttgatgacggattaattgaacttaacgca
cggaacctgaaagttaccccgctcggtaaaaactttctgcgtaatatatgtatggccctt
gacgcaaggctatgggctgataagcccaccacccagttattcagcatggctgtttaa

DBGET integrated database retrieval system