KEGG   Mucilaginibacter sp. BJC16-A31: MuYL_0315Help
Entry
MuYL_0315         CDS       T05010                                 

Definition
(GenBank) Glucuronoxylanase XynC precursor
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
muc  Mucilaginibacter sp. BJC16-A31
Pathway
muc00511  Other glycan degradation
muc00600  Sphingolipid metabolism
muc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:muc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    MuYL_0315
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    MuYL_0315
Enzymes [BR:muc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     MuYL_0315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_59 Glyco_hydro_30C Glyco_hydr_30_2
Motif
Other DBs
NCBI-ProteinID: ASU32218
UniProt: A0A223NRD6
Position
complement(330878..332350)
Genome map
AA seq 490 aa AA seqDB search
MLQNIKLIAFALLALAAFSGCSKKATLQTATVPIAPVTPPLSVKSDVAMWLTRADQAALL
AKQNAVLDFNSTINSNPTISIDSAITYQGIDGFGFTLTGGSADVINTLPADKKDDLLKEL
FLTDSTHIGISYLRISIGASDMSATDFTYDDLAAGTDVNLAQFSIDKEKGALIPLLKSIL
ALNPKIRILACPWTAPVWMKINTIGNNGFTGGSLNPVYYDAYATYFVKYIQAMKAEGITI
DAVTPQNEPLNPNNNPAMVMQANEEAAFIKNSLGPQFKAANIAAKIIVYDHNTDRTDYPI
AVLGDAAASAYIDGSAFHLYAGSINGLTTVHTAYPGKNIYFTEQYTPSTGAFAGDLSWHV
TNLIIGATKNWSRNVLEWNLATDAAYGPHTNGGCSTCLGAISISGGSVLSRNVSYYIIAH
ASKFVRPGAVRIASSDLSSLPNVAFENTDGSKVLIVFNTTAGNQIFNIAFNQKNVTSTLP
GGAVATYVFK
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgctccaaaacatcaaactaattgctttcgcattgctggccctggctgcattttcgggc
tgcagtaaaaaggctacattacaaaccgcgaccgtccctatagcgccggtaaccccgcct
ttaagtgtaaaatcagacgtagccatgtggttaaccagagccgaccaagcggcgttgtta
gcaaagcaaaacgctgtgcttgattttaacagcaccatcaactctaaccccaccattagc
attgacagcgcaataacctaccagggtattgatggatttggctttactttaacagggggc
agtgccgatgttataaatacccttcctgcagataaaaaagacgacctgttaaaagaactg
tttttaactgacagtacgcatatcgggatcagctacctccgcatttctataggtgcgtca
gacatgagtgctacagattttacttatgatgaccttgctgcgggaacggatgtaaacctt
gctcaatttagtatcgataaagaaaaaggagcattgattcccttattaaaaagcattctt
gctttaaacccgaagatcaggatcctggcctgcccgtggaccgcgccggtatggatgaaa
ataaatacgattggcaataatggatttaccggcggcagtttaaacccggtttattacgat
gcatatgccacttactttgtaaaatatattcaggcgatgaaggctgaagggattacaata
gatgccgtaaccccgcaaaacgaacccttaaacccaaacaataatcctgctatggtaatg
caggctaatgaggaagccgcttttataaaaaacagcttaggcccacagtttaaggcggca
aatatagcagctaaaattattgtatatgaccataacaccgaccgtactgactacccgata
gccgttctgggcgacgctgccgctagtgcgtatattgacggttcagcttttcacttatat
gctggcagcatcaacgggctaacaacggtgcatacggcatatcccggtaaaaacatttat
tttacagaacaatacaccccttcgacaggtgcttttgcgggcgacctttcatggcatgtt
accaatttaataattggtgccacaaaaaactggagccgcaacgtgctggaatggaacctg
gccactgacgccgcttatggcccgcacaccaacggcggctgctccacctgcctgggcgca
ataagcattagcgggggcagcgtgttatcacgcaacgtgtcttactatattattgcgcat
gcttccaaatttgtacggccaggtgcagtacgcatcgcctcgtccgacctttcatcgtta
cctaatgtggcctttgaaaacacggatggctcaaaagtgcttatcgtatttaataccaca
gccggcaaccagatttttaatatcgcatttaaccaaaaaaacgttaccagcacattaccg
ggcggcgctgtcgcaacgtacgtgtttaagtaa

DBGET integrated database retrieval system