KEGG   Mucilaginibacter sp. BJC16-A31: MuYL_1204Help
Entry
MuYL_1204         CDS       T05010                                 

Definition
(GenBank) hypothetical protein
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
muc  Mucilaginibacter sp. BJC16-A31
Pathway
muc00511  Other glycan degradation
muc00520  Amino sugar and nucleotide sugar metabolism
muc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:muc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MuYL_1204
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    MuYL_1204
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:muc03110]
    MuYL_1204
Enzymes [BR:muc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     MuYL_1204
Chaperones and folding catalysts [BR:muc03110]
 Intramolecular chaperones
  Others
   MuYL_1204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b WhiA_N
Motif
Other DBs
NCBI-ProteinID: ASU33104
UniProt: A0A223NTU9
Position
1313940..1316159
Genome map
AA seq 739 aa AA seqDB search
MCLCFTVNAQFHIIPQPLRLTPKPGTFTLKNNMVIGIDADNKATAIYLQSYLAKNYNLHL
KVRIKPTAAAIYLLLDSNRTKGDYFLNISRSSIKITGNSNGIFYGIQSLIQLLPQDGAAP
FRLAACEIVDEPRFQWRGLSLDVSRHFFTVDEVKKYIDVMAHYKLNVFHWHLTDDEGWRI
QIDKYPLLTDVGSKISFYEKQGKFRKLDNLIDGGRDGFYTKADIREVLKYAKERFVTVLP
EIEMPGHSEAAIFAYPWLGCKDSTGAKHRVRMLDPGDSTFTFMQNVLTEVIDLFPNQYIH
IGGDEAEVVDWLKSPVAVALMKKEGLTRPEQVQSYFIKRIEKFLLSKNKKLVGWDEILQG
GLAESATVMSWEGEAGGIAAAKMHHPVVMTPLPYMYFDAPQANESLEPIGWNPPVPWQMV
YNYEPQSKQLSTGDAKYIMGVQGNIWAEKVPNLKHLEYMVYPRALAVAELGWTAKENKDI
GRFADKLNMQYGLFKLWGLNARLPNIENMADVYTNHDHYSFVLNYPLKGAQVRYSINGKM
PDSTAAAAGFPLKIDEALTDTLKLSAYTTWLLGHQHILQREMVKHVVVDADDSIGNLQPG
LNFSLYKTKEVSYRKLDTIAPAAAGILSFPQPLVAAPAGSPLFNWVKVNGFIKIDTEDDY
QLTTGFEESPLLFLGNAKVMDRERNRYVEPQKALLHLKKGYYAIRGYYLADDTNSTQNLL
QLQTVGGKVLDPGAYLYHM
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgtgtttatgttttacggttaatgctcaattccatatcatcccgcagccgcttagactt
acccctaaacccggcacctttactttaaagaacaatatggtgataggcattgatgcggat
aataaagctaccgctatttacctccaaagctatcttgcaaaaaactacaacctgcattta
aaagtgcggataaaaccaacggctgctgccatctacctgctgctggattcaaaccgtaca
aaaggcgattactttttaaatattagtagatcatcgataaaaataacaggcaatagtaat
ggcatattttacggcattcaatcgcttatccagcttttgccccaggatggtgccgcgcct
ttccgtttggcagcatgtgaaatagtcgatgagccgcggtttcagtggcgcggcctgagc
cttgatgtaagccgtcatttttttacggtagatgaggtgaagaaatatattgatgtgatg
gcgcattataagctcaatgtgtttcactggcatttaacagacgatgaaggctggcgaatt
cagattgataaatacccgcttttaaccgatgttggttcaaagatcagcttttacgaaaaa
caggggaagtttcgcaagctggataatttgattgatgggggccgggatgggttttataca
aaagccgatattcgggaggttttaaaatatgcaaaagagcgctttgttacggtgctgccc
gagattgaaatgccggggcatagcgaagctgccatatttgcttacccatggctgggttgt
aaagactcaaccggcgctaaacaccgggtgcgcatgcttgacccgggcgatagtaccttt
acatttatgcaaaatgtgcttaccgaggtaattgatctttttccaaaccagtacatccat
atcggtggcgatgaggcggaagttgtggattggctgaaaagtccggtagccgttgccctg
atgaaaaaggagggccttaccaggccggagcaggtacagagctattttataaaaaggata
gaaaaattcttgctttcgaaaaataaaaagttggtcggttgggacgagatcctgcagggc
ggccttgccgagtcggcaacggtaatgagctgggaaggagaagccggcggaatagccgca
gccaaaatgcaccatcccgtagtgatgacaccgctcccttacatgtattttgatgcaccc
caggctaatgagagtctggagccgattggctggaatcccccggtgccctggcaaatggtt
tataattacgagccgcagtcaaaacaactgagtaccggcgacgccaaatatataatgggc
gtgcaaggcaatatctgggccgaaaaagtgcccaatcttaaacatttggaatacatggtt
tacccacgcgcgctggcagtcgccgagctgggctggacggccaaagaaaacaaggacatt
ggcaggtttgccgataagctgaacatgcaatacggcctttttaaattgtggggacttaac
gccagactgcccaatattgaaaatatggccgatgtttataccaaccatgaccattattca
ttcgtactaaattatccgctaaagggcgcgcaggttcgctactccatcaacggaaaaatg
cccgatagtacagcagcagctgccggtttccccctaaaaatagacgaggcgcttaccgat
accctaaagctttcggcatacaccacctggttgcttggccatcagcatattttgcaaagg
gaaatggtaaaacacgtagtagttgatgctgatgacagcataggcaaccttcagccgggg
ttaaatttttccctttataaaaccaaagaggtaagctatagaaagctggataccatagca
ccggcagcagcaggcatactcagctttccgcagcccttagttgccgcgcctgcgggcagc
cctctttttaattgggttaaggtaaacggatttattaaaattgatacggaggatgattac
cagttaactaccggttttgaggaaagcccgctgctatttttgggtaatgccaaagtaatg
gaccgcgaaagaaatcggtatgttgaaccgcaaaaagcattgctgcaccttaaaaaaggg
tactacgctattcggggctattatttggcagatgataccaacagtacccaaaacctttta
caactgcaaacggtcgggggcaaggtgcttgatccgggtgcctatttataccacatgtaa

DBGET integrated database retrieval system