KEGG   Mucilaginibacter sp. BJC16-A31: MuYL_2414Help
Entry
MuYL_2414         CDS       T05010                                 

Definition
(GenBank) glutaminyl-tRNA synthase (glutamine-hydrolyzing) subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
muc  Mucilaginibacter sp. BJC16-A31
Pathway
muc00970  Aminoacyl-tRNA biosynthesis
muc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:muc00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MuYL_2414
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:muc03029]
    MuYL_2414
Enzymes [BR:muc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     MuYL_2414
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     MuYL_2414
Mitochondrial biogenesis [BR:muc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    MuYL_2414
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: ASU34301
UniProt: A0A223NXL2
Position
2614252..2615718
Genome map
AA seq 488 aa AA seqDB search
MISTIAGKSDKYELVVGLEVHAQLSTLSKVFSSDSAAFGAGPNEHISPISLGHPGTLPKL
NKKAVEYAVKMGLACNCTINLRNTFARKNYFYADLPKGYQITQDQMPICLGGSVLVRLAN
GAKNIAIHHIHLEEDAGKSMHDQDHSDSLIDLNRAGVPLIEIVTEPDMRSSEEAGHFLTE
VRKLVRYLDICDGNMEEGSLRCDANISVRLRGATTYGNRCEVKNLNSIRNVQRAIEHEFE
RQVNIIENGGHIDQNTLNFNADTGETSVLRSKEMANDYRYFPEPDLTPLSLNQEYIDKVL
LTMPVLPNVLYEKYTAQLGLSDYDAGVITADKDFAQYFEQLIASTDNYKAAVNWLMGPIK
SYLNDHSLSITDFTLKPGTLAGLIKLVDSGKINNTVASHKLFPELVKHGDKDAATLAAEL
NLLISADNDDVSRFIQDAIAKFPDKVIEYKKGKKGVLGLFMGEIMKSSKGKIDPQKTNQL
LIKELESK
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgatcagtactatagccgggaaaagcgacaaatatgaattagttgtcgggttggaggtt
cacgcacagttatccactttaagtaaagtattttcgagtgattctgccgctttcggcgca
ggacccaacgagcatatcagtcccatttccctggggcatccgggcactttgcccaagctt
aataaaaaagcagttgaatacgccgtaaaaatggggcttgcctgtaattgcaccatcaac
ctgcgcaatacttttgcacgaaaaaattatttttatgccgatttacctaaaggctaccag
ataacccaggatcagatgcccatttgcttaggcggatcggtattggtaaggttagctaac
ggagccaaaaatatcgctatccatcatatccacctggaggaagatgccggaaaaagcatg
cacgaccaggatcattcagactcattgatcgatttaaacagggctggcgttccacttatt
gaaatagttacggagcctgatatgcgcagtagtgaagaggcaggacattttttaacagag
gtccgcaagctggtacgttaccttgatatttgcgatggcaatatggaagagggcagcctg
cgctgcgacgccaatatttcagtgaggcttaggggggcaacaacttatggaaaccgttgc
gaggtaaaaaaccttaactctatccgtaatgttcagcgtgctattgagcatgaatttgag
cgccaggttaatattattgaaaatggaggccatatcgaccaaaatacccttaattttaat
gcggataccggtgaaacatctgtactgcggtcaaaagaaatggctaatgattatcgttat
tttcctgagccggatctcacaccattgtcattaaaccaggagtatattgataaggtactg
cttaccatgccggtattgccaaacgttctttatgaaaagtacaccgcgcagttgggcctt
tctgactatgatgccggtgttatcacagctgacaaagacttcgcccaatattttgaacag
cttattgccagtacagataactataaagctgcggtaaactggctgatgggccccataaaa
tcctatttaaatgatcatagcctgtccataactgacttcaccctgaagccaggaacttta
gcgggtctgataaaactggttgattcaggaaagatcaataataccgtagcgtcgcacaaa
ctattcccggagctggttaaacatggtgataaagacgcagctacgctggctgctgaatta
aatttgctgataagtgctgataatgatgacgtgagcaggtttatacaggatgcaatcgct
aaatttcctgataaagttatagagtacaaaaaaggaaaaaaaggcgttttaggcttgttt
atgggcgaaataatgaaaagctcgaaagggaaaattgatccgcaaaaaacaaaccagtta
ttaattaaagaactggaatcgaaataa

DBGET integrated database retrieval system