KEGG   Mucilaginibacter sp. BJC16-A31: MuYL_4018Help
Entry
MuYL_4018         CDS       T05010                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
muc  Mucilaginibacter sp. BJC16-A31
Pathway
muc00471  D-Glutamine and D-glutamate metabolism
muc00550  Peptidoglycan biosynthesis
muc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:muc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    MuYL_4018
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MuYL_4018
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:muc01011]
    MuYL_4018
Enzymes [BR:muc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     MuYL_4018
Peptidoglycan biosynthesis and degradation proteins [BR:muc01011]
 Precursor biosynthesis
  Amino acid ligase
   MuYL_4018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C 3HCDH_N NAD_binding_8 AlaDh_PNT_C MutL
Motif
Other DBs
NCBI-ProteinID: ASU35903
UniProt: A0A223P185
Position
complement(4264420..4265781)
Genome map
AA seq 453 aa AA seqDB search
MDKRIKMESKKLIAILGAGESGVGAAYLAQQQGYDVFVSDFGGIADNYKQQLQDWNIRFE
EKQHTEDEILKAVEVIKSPGIPEKAPVVKKIKEKGIPVISEIEFAGRYTQAKIIGITGSN
GKTTTASLTYHILKNAGLNVGLAGNIGKSFAYQVATEKFDLYVLELSSFMLDDMFSFKVD
IAVLLNITPDHLDRYDYKLENYAASKFRISQNQTAVDYFIYCADDPETIKGMEGRSFAAQ
QLPFSIEKKIEQGAYLEQDNIVINTHQQHFQMSINELALQGKHNIYNTMASGIVAKVLEL
RNPSMRESMGNFKSIEHRLESVGKISGISFINDSKATNVNSTWYALESMTSDVILILGGV
DKGNDYSMLKDLVKQKVKAIVCLGKDNRRIHEAFEDVVDVIVNTHSAQEAAQVSYHLATK
GDTVLLSPACASFDLFKNYEDRGRQFKQAVREL
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggacaaaagaataaaaatggaatcaaaaaaactcatagcaattcttggggccggcgaa
agcggggtgggcgcggcttacctggcacagcagcaggggtatgatgtttttgtatctgat
tttggcggtattgctgataactataaacagcagctgcaggactggaatattcgttttgaa
gaaaagcagcacactgaagatgagatcctgaaagctgttgaggtaattaagagcccgggt
attcctgaaaaagcgcctgttgtaaagaaaattaaggaaaagggaattcctgtgatctcg
gaaattgaatttgcagggagatatacccaggcaaaaataattgggataaccggctcaaac
ggaaaaacgacaacagccagcttaacctatcacatattgaaaaatgcagggttaaatgtt
ggccttgcgggtaacataggtaaaagctttgcctaccaggttgcaacggaaaagtttgac
ctgtacgttcttgagttaagcagctttatgcttgatgatatgttcagctttaaagttgac
atagctgtgctattaaatataacacccgatcatttagaccggtatgattacaaactggaa
aactatgcagcgtcaaagtttcgcatctctcaaaatcaaacagccgtcgactattttatt
tattgtgccgatgatccggaaacaattaagggaatggaaggcaggagctttgcagcgcag
cagttaccattctctatcgaaaaaaagatcgaacagggagcatatctcgaacaggacaat
attgtcattaacactcaccaacaacattttcagatgtcaataaacgaattagcgctacag
ggtaaacataacatttacaacacaatggcatcaggtatagtagcaaaagtgctcgaactg
cgcaatccttctatgagggaaagtatgggcaactttaaaagcattgagcacaggctggag
tcggttggcaaaatatcaggcatcagcttcattaatgattcaaaagctacaaacgttaac
tcaacctggtatgcccttgaaagcatgaccagcgacgtgatactgatactgggtggtgtt
gataaaggcaatgactacagtatgctgaaagacctggttaagcaaaaggtaaaggcgata
gtttgccttggtaaggataacaggcgcattcatgaagcttttgaagacgtggtggatgtg
atagtcaatacgcattcggcgcaggaagcggcacaggtatcataccacctggcaaccaaa
ggcgatactgtattgctgtcgccggcatgtgccagttttgatctgtttaaaaattacgaa
gacaggggcaggcagtttaagcaggcggtgagagaattgtag

DBGET integrated database retrieval system