KEGG   Mucilaginibacter sp. HYN0043: HYN43_004410Help
Entry
HYN43_004410      CDS       T05668                                 

Definition
(GenBank) NUDIX domain-containing protein
  KO
K13522  bifunctional NMN adenylyltransferase/nudix hydrolase [EC:2.7.7.1 3.6.1.-]
Organism
muh  Mucilaginibacter sp. HYN0043
Pathway
muh00760  Nicotinate and nicotinamide metabolism
muh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:muh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    HYN43_004410
Enzymes [BR:muh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     HYN43_004410
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     HYN43_004410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX CTP_transf_like Pantoate_ligase
Motif
Other DBs
NCBI-ProteinID: AYL94585
UniProt: A0A494VTA3
Position
complement(1093450..1094346)
Genome map
AA seq 298 aa AA seqDB search
MKTAVIIARFQTPYLHEGHKELIAQVKQKHAKLIILLGVSPIKGSRKNPYDYYTREKMIK
KDYPEVVVLPISDNPSDKIWSENLDNLLKSVFSAEQFCLYGSRDSFIPYYSGKFETVELP
EHGDYNATELRKQYADKVFDSNDFRAGILYAYYNQYPKVYPTVDVALFRNNRSEILLGKK
AINNKWRFVGGFSDPEDACYEDAAKRELIEECGEMQTTAMQYETSAKINDWRYRSEVDKI
ITLLFSCDFIEGEPQAQDDIADLAWFKLTDLPLMIKDGAISEEHVDLFNFITSKYQKN
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccgcagtaattatagcacgctttcaaaccccataccttcacgaaggccataag
gagttgattgcacaggttaagcaaaaacacgccaagctgattatcttgctgggtgtaagc
cccattaaaggcagccgcaaaaacccttacgactattacacccgcgaaaaaatgatcaag
aaagactaccccgaagtagttgttctccccataagcgataacccgagcgacaagatctgg
tcggagaatttggataacctgctgaaaagcgttttcagcgccgagcagttttgtttatac
ggcagccgcgatagctttatcccctactacagcggcaagtttgagaccgtagagctaccc
gagcatggcgattacaatgccaccgaattgcgtaaacaatatgcggataaagtttttgat
tcgaacgatttccgggcggggatcctttacgcatactacaaccagtaccctaaagtgtac
cctacggttgatgtggccctgttcaggaataaccgcagcgagatattgcttggcaaaaag
gccatcaacaataaatggcgctttgtgggcggcttttctgatccggaagatgcctgttac
gaagatgccgccaaacgcgagcttatcgaagagtgcggcgagatgcaaaccaccgccatg
cagtacgaaacatcggccaaaataaatgattggcgctaccgcagcgaggtagataagatt
attaccctgctgtttagctgcgattttattgaaggcgaaccacaggcccaggatgatatt
gccgacctggcctggtttaaacttaccgatctgccattgatgataaaagatggcgcgata
agcgaagaacacgttgatttgtttaatttcatcaccagcaaataccaaaaaaactaa

DBGET integrated database retrieval system