KEGG   Mucilaginibacter sp. HYN0043: HYN43_007460Help
Entry
HYN43_007460      CDS       T05668                                 

Gene name
hemN
Definition
(GenBank) oxygen-independent coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
muh  Mucilaginibacter sp. HYN0043
Pathway
muh00860  Porphyrin and chlorophyll metabolism
muh01100  Metabolic pathways
muh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:muh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HYN43_007460 (hemN)
Enzymes [BR:muh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     HYN43_007460 (hemN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: AYL95141
UniProt: A0A494VN53
Position
complement(1923723..1925084)
Genome map
AA seq 453 aa AA seqDB search
MEPSLTAKYNVAAPRYTSYPTMPYWDTGAFTKEEWIKTVNSSFYESNAQEGISIYIHLPF
CENLCTYCGCNTRITKNHRVEEPYIKALLLEWAMYKNIFGGKPLIREIHLGGGTPTFFSA
ANLKALISAILLHTEVHLDASFSFEAHPANTTVDHLQVLYDLGFRRLSLGIQDFDPKVQF
IINRQQSIDQVRTVTGQARHIGYTSINYDLIYGLPLQTLAGLATTLQEVAALKPDRIAFY
SYAHVPWLKPGQRRFTEDDLPDAKLKTKLYDVGRALLKHYGYLEVGMDHFALPGDELLLA
EQAGNLHRNFMGYTHQHTQLLVGLGVSSISDSRYAFAQNVKSVEEYLELVKNGELPVFKG
HLLTNDDIIIRRHIQQIMCKGQTSWNHHTEPCEALLDGIERLQPLADDGLIELNSWGLKV
TPTGKNFLRNICMALDARLWANKPATQLFSMAI
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggaaccatcactaacagctaaatacaatgtggctgctccgcggtacaccagctaccca
actatgccttattgggataccggggcttttactaaagaagaatggataaaaactgtaaac
agctcattttatgagagcaatgcacaggaaggtataagcatctacattcatttacctttt
tgcgaaaacctttgcacctattgcggctgcaatacccggattaccaaaaaccacagggtc
gaggagccatatattaaagctttattgctggaatgggccatgtataaaaatatttttggc
gggaagcccctgatccgggagattcacctcggtggcggtacgcctactttttttagtgcg
gcaaatttaaaagcgctcattagtgctatcctgctgcatacagaagtacacctggatgca
tctttcagttttgaagcgcatccggccaataccaccgttgatcatttgcaggttttgtat
gatcttggtttcaggaggctaagtcttggcatccaggatttcgatcctaaggttcagttt
atcattaaccgccagcaaagtattgatcaggtgcgtacggttaccgggcaggcaaggcac
ataggatatacatccatcaactatgatctgatatatggtttaccgctgcaaaccttagcc
ggcctggcaacaaccctgcaggaagtagccgcattaaagcccgataggattgctttttac
agctacgctcatgtgccgtggttaaaaccaggccagcgccgtttcaccgaagatgatttg
ccggatgcaaaactcaagaccaaactatacgatgtaggccgcgcgctgttaaagcactac
ggttatcttgaagttggcatggaccatttcgctttaccaggagatgagctgctacttgct
gaacaggccggtaaccttcatcgtaattttatggggtacacccatcagcacactcaacta
ctggttggtttgggagtatcttctatcagcgattctcgatatgcttttgcccaaaatgta
aaatctgttgaggaatacctcgaactggtaaaaaacggcgaactgcctgtttttaaaggt
cacctgctaaccaacgatgatatcataatccgcaggcatatccagcagatcatgtgtaaa
ggccaaaccagttggaaccatcataccgagccatgtgaagccttgctggacggaattgaa
agattacaaccattggccgatgacggattaattgaacttaattcgtggggattaaaggta
acacccacaggcaaaaactttttacgaaacatttgcatggcgctcgacgcccggctttgg
gccaataaaccggcaacacaactgtttagtatggcgatatag

DBGET integrated database retrieval system