KEGG   Mucilaginibacter sp. HYN0043: HYN43_008665Help
Entry
HYN43_008665      CDS       T05668                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
muh  Mucilaginibacter sp. HYN0043
Pathway
muh00010  Glycolysis / Gluconeogenesis
muh00053  Ascorbate and aldarate metabolism
muh00071  Fatty acid degradation
muh00280  Valine, leucine and isoleucine degradation
muh00310  Lysine degradation
muh00330  Arginine and proline metabolism
muh00340  Histidine metabolism
muh00380  Tryptophan metabolism
muh00410  beta-Alanine metabolism
muh00561  Glycerolipid metabolism
muh00620  Pyruvate metabolism
muh00625  Chloroalkane and chloroalkene degradation
muh01100  Metabolic pathways
muh01110  Biosynthesis of secondary metabolites
muh01120  Microbial metabolism in diverse environments
muh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:muh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HYN43_008665
   00053 Ascorbate and aldarate metabolism
    HYN43_008665
   00620 Pyruvate metabolism
    HYN43_008665
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HYN43_008665
   00561 Glycerolipid metabolism
    HYN43_008665
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HYN43_008665
   00310 Lysine degradation
    HYN43_008665
   00330 Arginine and proline metabolism
    HYN43_008665
   00340 Histidine metabolism
    HYN43_008665
   00380 Tryptophan metabolism
    HYN43_008665
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    HYN43_008665
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    HYN43_008665
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    HYN43_008665
Enzymes [BR:muh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     HYN43_008665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AYL95361
UniProt: A0A494VNN9
Position
complement(2173675..2175090)
Genome map
AA seq 471 aa AA seqDB search
MKTINKIYINGAFTNPHGKEILPLFNPATGDRIGDVYLGDETDVNEAVKAAKAAFKTFSK
TSLKERGDILVRLYEAMIAREDDLNAAAVEEYGSPIAATKGRTRYSAQLFLDAKEAMENF
EFETKLEHALVVNEPLGVIAAITPWNANYTHICSKLAPAIATGCTMVIKPSELSAIQTQI
LTECFASANVPAGVINIVNGTGITVGAALTGHKDVALVSFTGSTNVGKLIERSATETLKR
VVLELGGKSPNVLLEDADLEKAIPLAIAIAFSNSGQACHAGTRLIVPERRIEEIKPLLKK
YTEDLKIGDLHSQETYIGPMVSQKQYETVQRYIKSGIEEGAELLVGGPGHPDGLEGFYAK
PTVFINVNTKMTIAQEEIFGPVLAVITYKTEEEAIEIANDTIYGLSAYVSSCDIDKAREV
ATQIISGRVLVNTAINKENKAPFGGFKQSGIGRTSGAYGLAEYVEPKVIAV
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgataaataagatttatatcaatggggcttttacaaatccacacggaaaggaa
attctcccattatttaatccggcgactggcgatcgcattggcgacgtctacttaggtgat
gaaacggacgttaacgaagcagtaaaagctgctaaggcggcctttaaaactttttctaaa
acatctttgaaagaacgcggtgatattcttgtaaggctttacgaagccatgattgcgcgc
gaagatgatttgaacgccgcagcagttgaagaatatggttctccaatagcagcaacaaaa
gggcgtacgcgttattcggcacagctttttttggatgcaaaagaagctatggagaatttt
gaattcgagacaaagcttgaacatgcgctcgttgttaatgagcccttaggtgtaatagca
gcaattactccgtggaatgcaaactatactcatatatgcagtaaactggcaccggcaatc
gcaacaggctgtacaatggtcatcaaaccaagtgaattaagtgccattcaaacacagata
ttaacagaatgctttgcttcagcaaacgtgcctgcaggcgtaataaatattgttaacggt
acgggaataactgtcggggctgccctcacagggcataaagacgtggctcttgtatccttt
acaggctctactaacgtgggcaagttaattgaacgcagtgcaacagaaacactgaaaaga
gtcgtattggaacttggcggcaaatcaccaaatgtattattggaggatgcagacctggag
aaagcaattcccctggcgattgcaatcgccttcagcaacagtggccaggcctgccatgcg
ggtacgcgtttgatcgttccggaaagaaggatcgaggaaataaaaccactgcttaaaaaa
tatactgaggatttaaagattggcgatttacacagtcaggaaacttatatcggtccaatg
gtaagtcaaaagcagtatgaaactgtccaacgatatatcaaatccggtattgaagagggt
gctgaattattagtgggcggccctggtcatcctgatggattggaaggtttctatgcaaaa
ccaaccgttttcattaacgtgaacacaaaaatgacaatcgctcaggaggaaatcttcggc
cctgtgctggcagttattacctataaaacggaggaagaggcaattgagattgccaatgac
actatttatggattatccgcatatgtaagctcttgcgatattgataaagctcgtgaagta
gcaactcaaatcatatcaggcagagttttggttaatactgctataaacaaagaaaacaaa
gcgccttttggcggatttaaacagtccggtataggaagaacctccggcgcgtacggtttg
gcagaatatgtagagccaaaagttatcgctgtttaa

DBGET integrated database retrieval system