KEGG   Mucilaginibacter sp. HYN0043: HYN43_023980Help
Entry
HYN43_023980      CDS       T05668                                 

Definition
(GenBank) glucosylceramidase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
muh  Mucilaginibacter sp. HYN0043
Pathway
muh00511  Other glycan degradation
muh00600  Sphingolipid metabolism
muh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:muh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    HYN43_023980
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    HYN43_023980
Enzymes [BR:muh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     HYN43_023980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_59 Glyco_hydro_30C Glyco_hydr_30_2
Motif
Other DBs
NCBI-ProteinID: AYL98157
UniProt: A0A494VRD3
Position
5790529..5792019
Genome map
AA seq 496 aa AA seqDB search
MKKNFTHVLLATCITLGVFSGQACGKKSTATPTTPTKPVDPPVTPTKSDVAMWLTTADQS
VTFTKQSTLINFSTAAGSGTTTINIDAGTSYQTIDGFGFCLTGGSASVINAMTAQKKDDL
LKDLFSTDDNHIGISYLRISIGASDLSATDYTYDEVLPGVKDDVDLKNFSIDMEKTDLLP
ILKKILAINPNIKILGSPWTAPTWMKLNTLGFNGFKGGTLNPAYYDAYAKYFVKYIQAMK
AEGITIDAVTPQNEPLNAYNNPAMYMESGDQAKFVKNSLGPAFKAAGLNTKIIVWDHNAD
NTAYPMDIFKDAAASAFVDGSAFHLYNGQINDLQAVHDAYPAKNLYFTEQYTPASGGFGG
DLNWHVTNLIVGATRNWCRNVLEWNLATNPTYGPHTDGGCDVCKGALTINSSSDVTRNVS
YYIIAHASKFVRPGAVRISSTAVGALPNVAFKNTDGSKVLIVLNSSGSQQTFNFKIDGKS
ATSTLANGAVATYVWQ
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaattttacgcacgtgctgttggcaacatgtattacattaggagtttttagc
gggcaggcctgcggcaaaaaatcaaccgctacacctaccacgcctaccaaaccggtcgat
cctccggttacaccaactaaaagtgatgtggctatgtggctcaccacggccgaccaaagc
gtgacctttaccaaacaaagtacgcttataaattttagcacggcagcaggctcgggcaca
acaaccattaatattgatgccggtacctcttaccaaactattgatggctttggcttttgc
cttaccgggggcagcgccagcgtaattaacgccatgacggcacaaaaaaaagacgacctg
ctaaaagatcttttttctaccgatgataatcacatcggcatcagctatcttcgcatcagc
atcggagcctccgacttgagcgctacagattatacttatgacgaagttttgccaggtgtt
aaagacgatgtcgatctgaaaaacttttctatcgatatggagaaaactgatttactccct
atccttaaaaaaatactggctatcaatccaaatatcaaaatattaggcagcccctggacg
gcccctacctggatgaagcttaatacccttggttttaatggttttaaaggcggcaccctt
aacccggcttactatgatgcctatgccaaatactttgtaaaatacatccaggctatgaaa
gccgaaggtattaccattgatgcggttaccccgcaaaacgagccgcttaatgcttataat
aacccggctatgtacatggaatctggcgatcaggccaagtttgttaaaaacagcctgggc
ccggcgtttaaagcggcaggtttgaataccaaaatcattgtatgggatcataatgctgat
aacaccgcctatccgatggatatttttaaagatgcagcggccagtgcttttgttgatggc
tcggcattccacctgtacaatggtcaaatcaatgatttgcaggcggtacacgatgcctat
cctgccaaaaacctgtacttcaccgagcaatataccccggcaagcggcggttttggcggc
gaccttaactggcacgttaccaaccttatagttggtgcaacccgcaactggtgccgcaac
gtacttgaatggaacctggctaccaatccaacttacggcccgcatactgatggaggctgc
gatgtttgtaaaggtgctttaaccatcaattcatcatcagatgttacacgcaatgtttcg
tattacattatagcccatgcatccaaatttgtacgccctggtgcggtgcgtatttcatca
accgcagtaggtgcattgcccaacgttgcctttaaaaataccgatggcagcaaagtgctt
attgtactaaactcgagcggaagccagcaaacatttaattttaagattgacggaaaatcg
gctacaagcacattagccaacggtgcggtagctacttatgtatggcaataa

DBGET integrated database retrieval system