KEGG   Mycobacterium ulcerans: MUL_0548
Entry
MUL_0548          CDS       T00435                                 

Definition
(GenBank) epimerase
  KO
K19974  2-epi-5-epi-valiolone 7-phosphate 2-epimerase [EC:5.1.3.35]
Organism
mul  Mycobacterium ulcerans
Pathway
mul00525  Acarbose and validamycin biosynthesis
mul01100  Metabolic pathways
mul01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mul00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00525 Acarbose and validamycin biosynthesis
    MUL_0548
Enzymes [BR:mul01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.35  2-epi-5-epi-valiolone 7-phosphate 2-epimerase
     MUL_0548
SSDB
Motif
Pfam: AP_endonuc_2
Other DBs
NCBI-ProteinID: ABL03237
Pasteur: MUL_0548
UniProt: A0PLL8
Position
557383..558168
AA seq 261 aa
MSRIAVAAPQWRIADCRAAAAAMAIRSGADELQIDFGGAHRGPRLDVPAEQAVVARIARS
IPVTALAVNHANDLGLIDEHGEPNAEAAALLCVALWCAVELGIGVLHVPGFRRSAPDSPQ
RVAGTAAVLRSICQRAERHGIAVAYESALSGAASAALVEAVGHRDLRVVFDIGNLLDFGH
RPGEFVSAVGELLHPDLHVKDPAASRVDVVSELRDVLSSPAPVRSLLVENDYRAIPGRLA
ADVAVCRGLIRSHATRMHSRC
NT seq 786 nt   +upstreamnt  +downstreamnt
atgagccgcatcgcggtggccgcaccccagtggcgcatcgccgattgccgtgcggccgct
gcggccatggcaatccgtagtggcgccgatgaactgcagatcgacttcggtggtgcccat
cgcggcccgcgccttgatgtgcccgcggagcaggccgtcgtcgcgcggatcgctcgcagc
atccccgtcaccgcgctggcggtcaatcacgccaacgatctcggcctcatcgacgagcac
ggggagcccaacgcggaggccgcggcgctgctgtgcgtggcgctgtggtgtgcggtcgag
ctgggcatcggcgttctgcacgttcccggatttcgccgcagcgccccggattccccgcaa
cgggtggccggaaccgccgcagtcctgcggtcgatatgccagcgcgccgaacgccacggc
atcgccgtcgcctatgaatccgcgctcagcggagccgccagcgcggccctggtcgaggcg
gtcggtcatcgcgacctgcgtgtcgtgttcgatatcgggaacttgctcgactttgggcac
cggccgggcgaattcgtcagcgcggtaggggagttgctgcacccggacctgcatgtcaaa
gacccggccgccagccgcgttgatgtggtcagcgaactacgcgatgtgctgtcttcgccc
gcgccggtgcggtccttgctggtcgagaacgactaccgcgccataccgggccggctggcc
gccgatgtcgccgtctgccgcggcctgatccgctcgcacgcgactcgtatgcatagccgc
tgctga

DBGET integrated database retrieval system