KEGG   Mycobacterium ulcerans: MUL_0707Help
Entry
MUL_0707          CDS       T00435                                 

Gene name
recD
Definition
(GenBank) exodeoxyribonuclease V (alpha chain), RecD
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mul  Mycobacterium ulcerans
Pathway
mul03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mul00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MUL_0707 (recD)
Enzymes [BR:mul01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     MUL_0707 (recD)
DNA repair and recombination proteins [BR:mul03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     MUL_0707 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Helicase_RecD Viral_helicase1 AAA_11 AAA_22 UvrD-helicase PhoH AAA_28 T2SSE AAA_16 AAA_25 Mg_chelatase AAA_29 AAA_5 NTPase_1 NACHT SRP54 AAA AAA_18 DUF2075 CbiA
Motif
Other DBs
NCBI-ProteinID: ABL03361
Pasteur: MUL_0707
UniProt: A0PLZ2
Position
complement(741037..742800)
Genome map
AA seq 587 aa AA seqDB search
MTIEVVDPADWRQAASASGPLRTFNEARVIDAADVHVAQRLAAMSGESDPVVLLAIAFVV
RALRGGSVCVDLSTIEAQVGIADLPWPAAGEWLAAVRASPLVGSPAVLRLHEDNLVYLDR
YWREEQQVADDILALLAARASASGPAIEVNRLFPPGYEEQRAAAKIALAQGLTVLTGGPG
TGKTTTVARLLALFAEQAQLAGKARLRIALAAPTGKAAARLHEAVQSQIDKLDAIDQQRV
RGLQATTLHRLLGSRPDTSSRFRHHRGNRLPHDVIVIDETSMVSLTMMARLLEAVRPQTR
LLLVGDPDQLASVEAGAVLADLVDGLGARHDTHVAALRRLHRFGESIGQLAAAIRGGDAD
RVVEILRAGDDHIEWINAADPTPQLRNVLLPHALELRRAGALGDTAAALATLDEQRLLCA
HRRGPYGIAHWNHQVQRWLTEATGEPIWSSWYAGRPVLVTANDYGLGVYNGDTGVAVLDG
TNRAAAPGALRVVIAGAQEPLKFATSRLSDVETMHAMTIHKSQGSQADDVTVLLPPADSR
LLTRELFYTAVTRAARKVRIVGPECDVRAAIARRAIRATGLRSRLQP
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcgaggttgtcgacccggcggactggcggcaggcggcgagcgcgtccggaccg
ctgcggacgttcaacgaagcccgtgtcatcgatgcggccgatgtccatgtcgcgcaacgc
cttgcggccatgtctggcgagtccgacccggtggtgttgctggccatcgcgttcgtggtg
cgcgcgctgcggggcggttcggtgtgtgtcgacctgtccaccatcgaggcacaagtcggg
atcgccgacctcccctggccggcggccggcgaatggctggccgcggttcgggccagccca
ctggtcgggtcaccggcggtgctgcgcctgcacgaggacaatctggtctatctggaccgg
tactggcgcgaagaacagcaggtcgccgacgacatcctggccctgctggccgcccgggcc
agcgcatcgggcccggctatcgaggtcaaccggctgtttccacccggctacgaagagcag
cgcgcggccgccaagattgcgctggcgcagggcttgacggtgctgaccggtggaccgggg
accggcaaaaccaccacggtggcgcggctgttggccctattcgccgagcaggcacagctc
gccggcaaggcgcgactgcgcattgcactggccgcaccgaccggcaaggccgcggccaga
ctgcacgaggcggtgcagtcgcagatcgacaaactcgatgccatcgatcagcaaagggtt
cgtgggctacaggcgaccacattgcaccggctgctgggcagccggcccgacacctcatca
cggtttcgccatcatcgcggcaaccggctgccgcatgacgtgatcgtcatcgatgagacg
tcgatggtgtcgctgaccatgatggctcgcctgctcgaagcggtgcgtccgcagacgcgg
ctgcttcttgtcggcgatcccgaccaactggcgtcggtggaggcgggcgcggtgttggcc
gacctggtggacgggctgggcgcgcgccacgacacccacgtcgcggcactgcgcagactg
catcggttcggcgagtcgatcggccagttggcggcggccatccgcggcggcgacgccgac
cgggttgtcgagatcttgcgggcgggcgacgaccacatcgagtggatcaacgccgccgac
ccgaccccgcagctgcgcaatgtgctgcttccacacgcccttgagcttcgacgcgccggc
gcgctcggtgataccgcggccgcgttggcaacactcgacgagcaacggctgctgtgcgca
caccggcgtggaccgtatggaatcgcgcactggaaccaccaagtgcagagatggctcacc
gaagcaacgggcgagccgatctggtcgagctggtatgccggacggccggtgttggtgacc
gccaacgactatgggctcggcgtgtacaacggcgacaccggggtggccgtcctggatggc
acgaaccgcgccgcggctccgggcgcgctgcgggtcgtcatcgccggcgcgcaggaaccg
ctgaagttcgcgaccagccgactatctgatgtggaaaccatgcatgccatgacgatccac
aagagccagggcagtcaagccgacgacgtgaccgtgctgctgccgccggcggattcccgg
ttgctgacccgggaactgttctacacggcggtcacccgggccgcccgcaaggtgcgcatc
gtcgggccggagtgcgacgtacgggccgcgatcgcgcgccgggcgatccgggcgaccggg
ttgcgttcccgattgcagccgtga

DBGET integrated database retrieval system